CAZyme Information: MGYG000000144_01059

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_01059
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		37095.9	9.7032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 273267; End: 274214 Strand: +

Full Sequence      

MTSNRYFFIVLLFLYTLLFIKGYANTTKEFSDVIVPEFPLQVKFANELVDLDRLDMYERF
DRELTTLCYMHSSTSLAIKRANRYFPILEPILKEEKVPTDFLYLAVIESTLNPRAVSPAK
AVGIWQIMPRTGREYGLEVNNDIDERYHIEKSTRAACKYLKDAYEKYGSWTTVAASYNAG
MGRISTELEKQLADRSFDLWLNEETSRYVFRILAMKEIFSSPAKYGYKLKAKQLYQPIRY
SEIKVDTTINNLAVFAQSKGVSYAQLKEANPWLRSRFLPDKSRKVYYIKIPMKDDLYYTK
RKFTTYKKEWVIDKK

Enzyme Prediction     

No EC number prediction in MGYG000000144_01059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	84	221	4.8e-26	0.9185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.46e-63	92	217	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.75e-27	69	293	93	313	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.18e-27	87	184	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	9.49e-22	102	214	3	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.66e-19	84	214	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF11673.1	4.71e-185	33	315	1	283
BCI62457.1	5.02e-131	25	313	35	323
QPH56370.1	1.92e-119	36	313	49	326
QUT60528.1	7.76e-119	33	313	46	326
QUT66947.1	7.76e-119	33	313	46	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.03e-24	58	293	79	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.03e-24	58	293	79	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	5.04e-08	108	215	85	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
Q7VKB7	2.68e-07	80	239	195	367	Membrane-bound lytic murein transglycosylase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=mltC PE=3 SV=1
A3N339	1.51e-06	80	239	193	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000197	0.999275	0.000135	0.000142	0.000127	0.000119

TMHMM  Annotations     

start	end
7	24