CAZyme Information: MGYG000000142_03005

Basic Information

• Species: Blautia_A massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A massiliensis
• CAZyme ID: MGYG000000142_03005
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000000142_12|CGC2	54190.76	4.7333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000142	3538467	Isolate	United Kingdom	Europe

• Gene Location: Start: 103719; End: 105146 Strand: -

Full Sequence      

MSSLTKVLAEEVRKIEETAAVARTMQTNRLTHHLMPPVGWLNDPNGLCWYKGRYHVFFQY
SPFEANGGLKFWGHYSSEDMISWRYEGVPLLPDSIYDCHGVYSGSAIAEKDKLHLFYTGN
IKMDGDYDYINNGRQSSTLHVESADGLHFGTKEVAVSCEDYPENYTCHIRDPKVWKEGEE
YRMILGGRQKSDQGAVLFYRSEDLKNWKFDSELTTEKTFGYMWECPDFFTLEGQEVLSVS
PQGLTREEFRFQNIYQSGYFILKDGKPEEKAFREWDHGFDFYAPQTFQDGKGRRILIGWM
GMPDADEEYVNPTAESEGWQHCLTVPREVTYKNGMLYQYPVEELNGLRKTGVSVSGSSSE
IPVNGPFDLDVQVKGEQGKVSLGENLFLEYQDGDVILTLSEKAGAGRKVRKAHVPSGVIE
NIRVLADTTAVEIYVNGGEVVFATRYYPETQEQAVKVEAVECDGKIYMLKNYVME

Enzyme Prediction     

No EC number prediction in MGYG000000142_03005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	340	1.3e-94	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	6.50e-168	39	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	2.73e-148	29	448	14	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	7.89e-145	16	467	14	478	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	5.11e-122	33	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.18e-116	33	438	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL20909.1	0.0	1	475	1	475
QCU01937.1	0.0	1	475	1	475
QYX26047.1	2.06e-180	1	471	1	469
QNM06260.1	4.29e-174	1	449	1	459
BCN29305.1	9.60e-166	1	458	1	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BWB_A	9.22e-72	13	459	31	479	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7VCO_A	1.91e-71	3	455	2	466	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWC_A	1.38e-70	13	459	31	479	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	9.28e-67	9	459	18	497	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
1UYP_A	1.06e-63	32	471	6	429	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	6.80e-117	10	448	14	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	4.23e-91	29	468	34	482	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P37075	7.56e-91	33	453	31	444	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P40714	1.61e-89	33	459	29	461	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P27217	9.23e-89	33	448	31	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000142_03005.