CAZyme Information: MGYG000000135_02704

Basic Information

• Species: Murimonas intestini
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Murimonas; Murimonas intestini
• CAZyme ID: MGYG000000135_02704
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	MGYG000000135_5|CGC7	63491.51	8.0681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000135	5745007	Isolate	Canada	North America

• Gene Location: Start: 291478; End: 293106 Strand: +

Full Sequence      

MLNKLSLYWHTIRYLKIKQIYYRILKKLGLHCSHGVYLLKKQRTENIFIVNTIEELDFDP
VFLSRFSADSLLSDKITFLHDDEVFQWYSCWYFPEHSELWNYNLHYFEFIFVLLNAFKKE
NDEIYLDKIKECISGWIAENPRGRGVGWNPYTIALRLANWISVYKTLCSYLQNDSIFEKK
MLDSMYQQYTHLSMHLEKDLLGNHYLEELKTLLLCALFFNDSKMLHKSIRALKKQCREQI
LPDGMHFELSPMYHKIILEDLLRINVALRSAGQPDEELESYLQPMLNVAYSFENETFRIP
LFNDSGNNISKSLDALLTTAKKYFGLTPYLKNQMPDSGYYIFTYGIWKLIVDAGKPGPNY
IPGHSHCDGMSFELFKNGKPIIVNCGTYAYQCKERIFFRSTSAHNTVMIDRTEQSQCWGN
FRLAKRASITLLNINKHTISMKLVDQNGGCVKRTICFDNKRLKITDISDKGKLSAFLHFD
TDLVEIKNKIWRIPKVGICHIDADYIQMTQMDYAPEYGYKSKIKTLVLNGFEKVGCCICF
DE

Enzyme Prediction     

No EC number prediction in MGYG000000135_02704.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	338	446	1.3e-24	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	1.24e-34	334	431	9	107	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
COG5360	COG5360	1.97e-16	97	417	89	401	Uncharacterized conserved protein, heparinase superfamily [Function unknown].
pfam16889	Hepar_II_III_N	1.06e-12	125	324	130	336	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK43911.1	1.07e-130	2	478	4	490
BCS56822.1	4.53e-121	1	518	3	513
BCA89078.1	7.75e-121	46	530	9	483
QNU66806.1	5.23e-119	3	529	3	557
QUO20838.1	1.27e-110	1	528	1	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MMH_A	4.55e-18	122	524	132	571	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	4.55e-18	122	524	132	571	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
4FNV_A	7.84e-12	16	432	62	537	CrystalStructure of Heparinase III [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59289	2.56e-17	122	524	156	595	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
Q89YR9	4.29e-11	16	432	62	537	Heparin-sulfate lyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=hepC PE=1 SV=1
C7EXL6	5.48e-11	92	447	117	527	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000135_02704.