CAZyme Information: MGYG000000133_02696

Basic Information

• Species: Blautia_A caecimuris
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A caecimuris
• CAZyme ID: MGYG000000133_02696
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000000133_13|CGC1	55440.7	5.2325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000133	3329211	Isolate	Canada	North America

• Gene Location: Start: 65131; End: 66558 Strand: -

Full Sequence      

MSALTKVFTDEIRKIEETHWAEMVSKPYRLTHHLMPPCGWLNDPNGLSWYQGRYHVFFQY
SPFEVKGGLKFWGHYSSEDLINWTYEGVSLYPDSPADCHGVYSGSALAEEETLHLFYTGN
VKLDGDYDYINNGRCANTLHVESKDGIEFGIKENVIPCTQYPEDYTCHIRDPKVWKEGDR
YRMVLGGRRKDDHGAVLLYSSRDLKQWNLDGELTTEEKFGYMWECPDMFELSGNEILSVS
PQGVEREEYRYQNIYLSGYFILRDGKVFKEDFREWDMGFDFYAPQTFVDKKGRRILIGWM
GMPDAEEEYVNNTLEEGWQHCLTVPRELKYCNGKVYQYPVEELMNLRRWKKKLCDADRET
ETDGAFDLELQVQKGPAKVVLADIFKLEYRDGILVLEMDQQAGAGRRTRKARIEELRSIR
ILADTSAAEIYVNEGEVVFSVRFYGKGTKHRLKIEAEGFRGGIWKLEKMNITRCL

Enzyme Prediction     

No EC number prediction in MGYG000000133_02696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	339	1.5e-94	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.27e-165	39	332	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.98e-146	25	444	10	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	2.19e-144	1	468	1	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.97e-120	33	339	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	2.17e-118	33	435	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL20909.1	6.19e-234	1	467	1	470
QCU01937.1	3.56e-233	1	467	1	470
QYX26047.1	1.02e-180	1	468	1	469
QNM06260.1	5.67e-172	1	472	1	484
BCN29305.1	6.30e-164	1	469	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.18e-73	20	470	17	481	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	5.01e-71	24	447	44	463	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	7.51e-70	24	447	44	463	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	2.54e-66	21	469	25	488	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	1.05e-57	28	469	2	430	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.10e-109	13	466	11	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P37075	1.50e-90	28	444	27	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P40714	6.99e-88	33	466	29	476	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P27217	7.23e-88	33	444	31	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
A1STJ9	2.62e-85	6	468	74	538	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000133_02696.