CAZyme Information: MGYG000000133_00716

Basic Information

• Species: Blautia_A caecimuris
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A caecimuris
• CAZyme ID: MGYG000000133_00716
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000000133_2|CGC4	94435.66	6.3997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000133	3329211	Isolate	Canada	North America

• Gene Location: Start: 164050; End: 166494 Strand: -

Full Sequence      

MSREIFEVTKDRFHLKDPCQYILQGTWPKEAKMRACLDGSEVKAEIQRLEVVSALERFKD
PDLMRGERITASVQLPQSLEGCQKLTVYADMPDRRICWFSVSARELEKRRGKPQFFIEEE
KVQQGFLRIRGWAVADEPVKIQIFDENKQKLNVEILRTQRVDVEQLYEEMDSEDKSGFFV
ELTNLTGKLLYLVFYAGDTKSVHIVHLNPAVVFRKKIEKYAKKGLRYWKSQGSAAMVGKV
VSKVKTASTREIPYQKWIVRHLPGSKELEKQRRTKFEYQPKISIVVPLYKTPEKYLRQLV
DTVKAQTYPNWELCLSDGSGADSPIRKLLESLASSDERIKVIFHEKPLQISENTNAGIEA
ATGDYIAFADHDDELTPHALFQCVKALNENRDIRILYSDEDKMSMDGHKFFQPHFKPDYN
PDLLCTVNYICHLFVVDREIISQVGMLRKEFDGAQDYDFIFRCVETVKPEQIYHIPRILY
HWRCHEDSTAENPESKTYAFEAGKRAIEEHYKRTGINAEVLQGEFLGLYRTRFIRDHDPL
ISIIIPNKDHIADLKRCMDSIDKKSTYQNYEYIIVENNSTEEETFQYYKKLEAENPKAHV
VYWDREFNYSAINNYGATFAKGEYILLLNNDTEIINEDCLEQLLGYCMRSDVGAVGARMY
YEDDTIQHAGVVIGFGGIAGHCFVLQPRGTTGYCHRIICAQDYSAVTAACMMVKRSAFNE
VGGLTEELAVAFNDIDFCMKLRAAGYLIVYNPYAELYHYESKSRGLEDTPEKVARFNKEI
QIFERRWPDIMRDGDPYYNPNLTLKSQDFSLKRI

Enzyme Prediction     

No EC number prediction in MGYG000000133_00716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	283	393	7e-25	0.6470588235294118
GT2	542	665	1e-19	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	4.56e-103	280	484	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.68e-40	543	760	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.74e-27	539	765	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.95e-23	283	441	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	6.95e-21	283	489	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24563.1	0.0	1	814	1	814
CBL21587.1	0.0	1	814	1	815
QCU01344.1	0.0	1	814	1	815
QBE99396.1	0.0	1	814	1	816
QJU15224.1	0.0	1	814	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.15e-11	282	390	7	112	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	1.36e-11	280	373	5	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.51e-157	280	811	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	7.86e-100	254	813	293	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	1.28e-14	278	729	11	485	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q58457	2.15e-13	279	464	7	195	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71057	2.96e-13	280	508	4	235	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000133_00716.