CAZyme Information: MGYG000000132_02378

Basic Information

• Species: Beduini sp902363625
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Beduini; Beduini sp902363625
• CAZyme ID: MGYG000000132_02378
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000000132_8|CGC2	61380.01	6.8146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000132	2897757	Isolate	Canada	North America

• Gene Location: Start: 116746; End: 118320 Strand: -

Full Sequence      

MDKMNKGMKLIKELKIKRLLRSLNIYLFGDFFLYQGWLRKNLNHPDYKIALTDKVMIYIC
DTNHKLLSRTLNSIKKQTYSYYEVKVIQPADLSQLMVTADYCLFLEAGDRLTKNCLCELM
RNIKDQDAVYSDHDLYGRISFSRPKFKPDFSIDLLRSYPYIHHAILFTKEAISKVDTNCF
NAFMYEQMLNLFTDKRLVGHIPNVLFHFRREMLITKALGDVLLKHYQKLGLAVKIDQSSF
YFQSEYIPKVELVSIIIPNKDHTDDLKKCIDTIFKYTDPNLFEIIIVENNSETKEIFDYY
EELNKIKNIRVVYWESIFNYSAINNFGATFANGDYLLFLNNDVEIMNKDWLLRMLGVIQR
EEVGIVGAKLLYGDRKIQHGGVVIGTWGLAAHMFLGQDENYQGYMYRAAVKQDLSAVTAA
CLMTKRDLFFELGGLEEDLKVAFNDIDYCLRVRTKDKLVVFDPEVVLIHHESLSRGSDEV
SIEKKQRFDSEVAFMKERWESFLIDGDPYYNVNLTLDRTDYMIK

Enzyme Prediction     

No EC number prediction in MGYG000000132_02378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	254	429	6.2e-21	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.65e-36	255	471	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.54e-24	253	477	5	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.01e-18	254	429	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	1.56e-16	55	210	5	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	1.45e-13	255	368	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99393.1	4.50e-119	55	524	80	605
QQQ92271.1	1.78e-118	62	524	87	605
QJU15221.1	2.24e-118	62	524	95	613
ASU27528.1	2.24e-118	62	524	95	613
ANU74723.1	2.24e-118	62	524	95	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.22e-06	251	342	5	94	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	8.39e-63	101	524	451	898	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.14e-55	100	520	403	837	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000132_02378.