CAZyme Information: MGYG000000129_00399

Basic Information

• Species: Marseille-P4683 sp900232885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Marseille-P4683; Marseille-P4683 sp900232885
• CAZyme ID: MGYG000000129_00399
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1421	MGYG000000129_2|CGC1	157881.22	4.1461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000129	2720267	Isolate	Canada	North America

• Gene Location: Start: 16933; End: 21198 Strand: -

Full Sequence      

MKKSRRILSVGLALTMVAGMMISTSPVSTATPSSGEERNLAYHRMAYQSSAVDFNETAQL
ITDGIVGEDITWSAPTLTSPSGSTSGMFDDMIYSGGSGSASEENPLILQFTPSKPTAVTR
YDISARAGSNAPGNWTFEGSQDGENWDVLDTVEGNTFDTYRSNGSWATLDFPIDNQTVYS
YYRLRITGSATGSGYLNVAEVDFFESSKYGDYVNLKYSPFVSRWTSEGAGEQWVYVDLGA
ESTFDELRLTWSEENYATKYQIQVSDDAENWKTVANVKNQKGGAVSNKIPTKTARYVRVL
MEESAGDKYSLQEMEVIGTNGLSYTIDPMPGESEDGTQPLTGGNWKVERESAIGDVNGEE
VASASYDDSTWLPAVVPGTVLTSYLEAGAVPDTNVSDNQLAVSDSYFRSNFWYRNNFVVP
KEKQGQKVLLNFDAVSWKAVVYFNGQELGEINGAYTRGQFDVTDLVNYGEKNYLAVRIIA
PEHPGLTTCQDADTTNTNGGMLGADNPSIHASVGWDWVPTIRGRNIGLYDDVFLSYREGD
IHLTDPWIETVFDKDDEGNVDLSKAHLTVRTEVTNPTDSEKTATVQGTIQPGNIDFSQGN
ITLAAGETKEVAIQVDVDEPQVWWPNTYGDQPLYTCEIQSATGSSWWPAIEDTQTFQFGI
RQLEFTRTGEQGSGWGSSNSSALNLYCNGVRIFLKGGNWGMDDSNLAADAEDYDTKVRLH
AEANFTMIRNWVGQTWKEEFYDACDKYGILIWDDFWLANPSDGPDPVDREMFFDNATDKI
KRNRKHPSEAIYCARNEGIPPADIQEFLTSTVAGKANIGNDGVEEVGSLDGSRYYVKASN
KEDFGINGEGPYTVQTPRNYFSSSNAGANPQLHTERGMPNFPAYESISKMLGEDHQWPMD
DVWGIHDFANSGAQNARQFKNFMYAYEAEENIDNLKDFSRIAQMVNYEGHKAMFESFAED
NSSGLLMWMSQSAWPSTVWQIYDYYYDTNAGYYALKTASQPLNIIWNPTQESAQNETVGP
MYNPNPNTISITNDTGKEYADLTARIRIYDMNGNLLSTQEETAETIAVDEVKPMFAVEWP
TGEDVTPIKFMQCEIVDADGNILASNFYWENTESYRDYQAMSTLEQAQLDGQVLSADTEG
DVYRYTIQVSNNTEIPAVMTRVKTMQPDGTELVLPTYYSDNYFALMPGQTKEISVEFDKD
KLQGEAPIFKMEGFNTAEAQIEAKEEFEITVETDKDSYLTNESIIMTIVTPDDVDRVGLK
NERGKYLGIQKMAVRVEPGRRIWTVTTSVGTAGDNRQISVVMHTADGWSDPVATATIDVS
IAPPEVEPKLLEVSADKYNAGVNEDIIVTVETTTSVEKISLQNERGKGFGCTVLSKEDRG
DVRTWKIKFCIGTAGNRQVTVLGKWEGGFLEDTLPLNFVIR

Enzyme Prediction     

No EC number prediction in MGYG000000129_00399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	336	1062	7.3e-78	0.6715425531914894
CBM32	222	314	5.1e-20	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.29e-40	323	1025	1	655	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18368	Ig_GlcNase	1.09e-23	1106	1216	1	104	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
PRK10150	PRK10150	3.39e-15	410	797	66	417	beta-D-glucuronidase; Provisional
pfam00754	F5_F8_type_C	2.64e-12	222	316	24	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
PRK10340	ebgA	5.66e-11	413	797	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59728.1	0.0	1	1421	1	1421
BCI59726.1	0.0	13	1221	14	1319
BCI60689.1	2.95e-309	4	1215	6	1198
QRO23425.1	5.66e-254	38	1218	64	1199
QIX64986.1	4.65e-242	32	1215	66	1205

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZO_A	1.40e-52	321	1223	35	898	Crystalstructure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZS_A	3.26e-52	321	1223	35	898	ChitosanProduct complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZT_A	4.31e-52	321	1223	35	898	Complexof Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	4.05e-51	321	1223	35	898	Complexof Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]
2VJX_A	6.02e-40	371	1208	25	829	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5H7P5	1.67e-86	336	1218	2	947	Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum OX=4690 GN=EBM PE=1 SV=4
Q75W54	4.73e-81	345	1215	13	935	Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana OX=3702 GN=EBM PE=1 SV=3
Q82NR8	7.33e-66	318	1223	27	903	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
Q56F26	1.35e-51	321	1223	35	898	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
D4AUH1	1.09e-41	367	1197	62	862	Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000482	0.998547	0.000321	0.000268	0.000183	0.000156

TMHMM  Annotations     

start	end
7	29