CAZyme Information: MGYG000000127_04828

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_04828
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774	MGYG000000127_10|CGC6	88386.42	6.88

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 176615; End: 178939 Strand: +

Full Sequence      

MDIIDKKNFIFIEPEIKDTDEKKQQPASYIRKTFNVVKTVKQARAYMTALGVYEPYLNGN
RLGNGMLLPGFTNYRRRVQYQEFDITQFIRFGQNIFGCVVGDGWYRGNVGAFNKRNVYGN
KLKFACRLRLIYEDGNEEVISTDASWRATQEGPVRENDLKILEVYDARKELCNWTTPEVG
FDDSNANGWHKCRESSYKGEIVPMHGEAVLEQEHFSPKILHTPDGSIVLDFGQNHAGHVE
FTVTGKAGTKVSLIMGETLDEQGNFTLKNLQGEGKGAEIMPVGQRLDYILKEGEQSYKST
FLISGYQYVKLENWPEDVLRENFRAIAVYSDLKQTGTFTCSNENINQLVKNVRWSQKSNF
VDIPTDCPQRERAGWAGDINVFLETANYLTDTRKFIRKWMQDFISSQDKNGALPYIIPEV
PAIGAGKSSAGWSDAISTIPLTQYAFYEELDEIEASYDAVKRFVEYNRKRAYRRHLLHIY
RVQPHYNYILDTGFHYGEWLEPGGSNIKDALKAMILPDAEVATAWFYYTTKNLVKMAGLL
NKQEDVRKYSLLAQKIRDAYRKEFLPGGQVHSHRQCKYVRPIYMGLAETSEIPQIAERLN
HLCIANKYRIGTGFLTTYQILQVLTDCGYVETAYKMLENEDCPGWLYEVKKGANTVWEGW
DAISQKDGRLNPLSLNHYAPGAVVSWLFSHCAGIQPKAPGFKKIEIRPVIGGSLTFVRAE
YESIKGKIVSAWRIEGEKFILEVKLPEEIEARVVLPDGTIYECAQTGCYECNMS

Enzyme Prediction     

No EC number prediction in MGYG000000127_04828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	220	755	4.4e-150	0.996031746031746
CBM67	20	191	6e-31	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.91e-102	333	690	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.97e-53	38	209	1	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.23e-22	693	759	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.10e-21	221	329	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL03771.1	2.94e-285	7	769	8	759
QRV18100.1	2.94e-285	7	769	8	759
AHF24557.1	9.80e-190	7	762	16	744
QTE67956.1	2.83e-188	11	774	15	752
QBD76857.1	4.37e-178	18	755	131	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.37e-126	27	756	302	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.59e-117	31	756	135	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	6.98e-104	27	756	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.71e-126	27	756	302	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	7.78e-113	29	756	176	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.55e-97	29	756	172	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	5.08e-71	27	755	184	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_04828.