CAZyme Information: MGYG000000127_02466

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_02466
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
934	MGYG000000127_4|CGC3	106609.4	4.7548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 187807; End: 190611 Strand: +

Full Sequence      

MKKLKNITCSGLENPLGLDREHVDFSWQLDTDQCNIYQRSYEINVWDEYGHPVWASGPVD
SDQCLYVPYGGATLKSRTGYEYQITVTDNDGSVITGRRMTFETGMDVCDWNAKWIGRQIP
EDKEAGPDPDGDYGQILVDMMQGRDVHFHPDRKLEPCNVYERRFTIPKERALKKARIYMT
ALGIYQLVVNGETPDDQLFAPGFTKYEEYLEYQVYDVTGLLYSGENCIRVTLADGWYKGK
FGILGLGESYGDELAFLMELELTYDDHTKQHILSDDSFLYTQSPWCYADILIGCRYDARL
EQNASMQPETHALAGMKVSKQPEARALAGTNPNQWRPARIVDFPYTPLKAPCTQPVRSIM
ELAPAAVLTSPKGETIIDFGQNLVGVIRLRVSGPSGIVIKLEHSEVLNKDGTFENFVDGF
NRDQTDYYVLKGAYEEVWQPQFTFHGFRYVKISGYPGEVNKEDFTAIVIGSDCRITNEFY
TSNAQLNRLQENIMWSQRGNLLSIPTDCPQRERAGWTGDVWVYGETCCINQDCHTFFIKW
LRNLRLEQFDNGLVPIVIPYIRAYEALQLKSFGTHTSAGWGDVIVALPWYLYEIYGDRQA
LEENFEAMEKWMAYVTREAESGVKIKEGTDGTSGSDVDQEALERQKYLWNTNFHFGDWLY
PSCQNENGEADMFASANTTKELVATAIYAHSANLMAKICGVLGKPERSRYYSELNTHIRE
AFDAEYVSVDGVLEQELQGLYVMALAMDMVPEKKRGKMAERLNTLIKENGNCLDTGFMSI
KFLMDVLMDTGHENTAKALLYQNKCPSWLYEVEKGATTIWETWNSIREDDTRGRFSYNHY
AFGCIGDWMYRNLLGIRRLEPGFSKVLIAPNFDLGLEYAQGKFDSVYGTIEVKWRKRPDL
RPELFVKIPANVTAYIKLPGEVVREIGNGSYTFS

Enzyme Prediction     

No EC number prediction in MGYG000000127_02466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	369	918	1e-162	0.9940476190476191
CBM67	161	304	9.8e-20	0.7443181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.64e-107	476	853	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.28e-43	171	361	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.84e-37	369	469	2	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.60e-19	855	933	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI36516.1	3.49e-269	4	934	16	938
AYA78378.1	7.47e-261	4	922	7	887
ABF44215.1	3.28e-252	7	934	8	928
QKS44705.1	4.09e-245	6	926	12	905
QIG39450.1	2.87e-215	1	919	1	896

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.45e-152	12	934	14	1029	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.91e-137	16	930	16	858	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.12e-122	6	919	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.77e-152	12	934	14	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	7.90e-143	1	919	32	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.62e-121	11	914	39	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.88e-67	14	929	42	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_02466.