CAZyme Information: MGYG000000127_00027

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_00027
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000000127_1|CGC1	95540.15	6.3579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 28068; End: 30530 Strand: +

Full Sequence      

MERNYLRPDSFIELDFTTEEHIGIHMHSDIEFLFVISGRVAVRVEENIYRLGPGDMLLVN
VNRNHSYSASPDIVMGRFLIAYNKIREYLGKSEVLFWCNSAEDVNSAYEELKKLVCRIFN
QYMYKGSANSLYLYSLYFQMMHLMAENFLLSVDDRRYDIKSEPEDQRLQKIFAYIRTNYS
QNITLDDMAKELYLSPTYISKYITKHCGMRFMELLTAVRLNHAVEDLLYLDASIMKIALD
NGFSSVAACNKAFKDAYQMTPSEFRKQRKSGRDELSAQEQEKRKKIKKSVDEYLNRSPEK
QDISVSLTELPILLEADAPALEHWNRCGLKMINAGAAQDLMNTRLCEQIVERRELLGFEY
VRFWDIYAPEMYLDINAAHEEQNYSRLDIVTDFLVKNHLKPYIELGAKPVRLLRSTKNPV
TEIKRTLTFNSREQEQRFYAGLARHFVSRYGADEVKTWYFELWENTQIRFENQADFLYSE
MSEQDHRIYFGMFNRVAGAIRKVIPDAHIGGAGFPVRLYRQEGFNKILLLWKREPEQPDF
ISITCFPYSLEKEGSRYYEKRITDMDFVRHNINLADKAMAEAGMAEKKLHVSEYSFSLSN
RNVVNDSCLKGAFLAANAISCFEKADIAAHWLFSDIYADAKDTGTVLFGGCGILTKGGIP
KPSYYAFEFLNRLYGEVLIKNDHVMITRGRGASFRILCHNLKRPNYNYYIMEEDQVSVNN
LSAILDDREFLTIRVEICHLETGVYLLRKNRVNRNCGSVQDKWMDLNMEPGLTMKEQEYL
EKSSISEIKFLEQSTIGDVLHFEVALEPNEIQFIDIRKKD

Enzyme Prediction     

No EC number prediction in MGYG000000127_00027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	330	765	1.6e-53	0.9559164733178654

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.53e-29	347	678	37	355	Glycosyl hydrolases family 39.
COG2207	AraC	1.56e-24	161	273	15	127	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	5.30e-21	182	265	1	84	helix_turn_helix, arabinose operon control protein.
COG3664	XynB	5.59e-20	340	817	1	425	Beta-xylosidase [Carbohydrate transport and metabolism].
pfam12833	HTH_18	5.04e-19	188	267	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58080.1	5.38e-179	3	820	2	802
AQR96769.1	1.48e-175	3	820	2	802
AQR96727.1	1.21e-129	9	816	4	790
ASU27451.1	2.71e-126	3	816	2	800
ANU74646.2	2.71e-126	3	816	2	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BS9_A	3.49e-33	353	818	43	482	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	4.69e-33	353	818	43	482	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BFG_A	4.69e-33	353	818	43	482	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
4M29_A	7.65e-27	356	816	54	496	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.37e-26	356	816	54	496	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	1.60e-30	353	818	43	483	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	4.67e-28	325	676	21	359	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
O30360	3.23e-24	316	700	10	384	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	7.68e-24	316	700	10	384	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q99XB1	9.39e-23	34	818	27	741	Uncharacterized HTH-type transcriptional regulator SAV0101 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0101 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_00027.