CAZyme Information: MGYG000000125_02211

Basic Information

• Species: Clostridium_B tyrobutyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_B; Clostridium_B tyrobutyricum
• CAZyme ID: MGYG000000125_02211
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699		83510.77	5.9309

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000125	3256597	Isolate	Canada	North America

• Gene Location: Start: 89664; End: 91763 Strand: +

Full Sequence      

MLLSIGMMVKNEEKHLDECLKSLLPILEKLDSELVIVDTGSTDRTVDIAKKYTDKVYFHK
WNNNFSEMRNITIGYCSGEWFFYIDGDEILESCEDIINFFKSSEYKSYNTAGIYIKNLVD
LSNTNNYSVFSAIRLFRKDREFKFIGAVHNQPQWKQPIKYLSSSCIHYGYISTDKELMEK
KFKRTSSILKKELEKNPGNIYYMYQLSVSLSMHGDFKEASEQIQKTYDYIKKKNIDIKQY
FYVIPHISLCYLNQKEYEKSKKYAQECLSYNRDYIDAYFYLGYSQFMLKEYKESLNNFIE
YERLIKDYKKLLNNPGNIYYTIGRINDVYFYMYIGYRELKNVDKAVEYLLKIEDKKYNIN
KEIVSIFIDNNMYDKLLEYVNKLIGEEKNSQLEEIYVYIEWYKIRIDKSESNKLTEIFTN
DRTPYGKLNSIRIKYMCKDSDLLTDIENLLAVVGIEKTRDYYGDLLYYMLKYKKDISQFV
VNAPYGIINNFIRYISVKYDDLWDTICDYIEIYAGNGDFASLKINKELCRYSLLLGKNKL
GEDKFQNIFIKYIDIGIEYINKIYTDFALENERYMEARTQEEGFFMFLRKAKQIKDNDKN
TYVQYVRRALEIYPCMKDGIKLILDEIKAEDDVSNNEFEQYKIRVKDTIKSLIENDRLED
AGEIIKEYEDIVKDDVEIMLFKSQISLKKLKQVNTNYKM

Enzyme Prediction     

No EC number prediction in MGYG000000125_02211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	105	2.4e-17	0.6352941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	2.37e-34	3	196	2	190	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	2.86e-15	4	152	1	154	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	4.78e-14	4	87	3	91	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd00761	Glyco_tranf_GTA_type	4.60e-13	5	91	1	91	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
TIGR04195	S_glycosyl_SunS	1.33e-11	3	242	59	290	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALU37411.1	1.10e-242	1	699	1	697
AGY77269.1	1.10e-242	1	699	1	697
AVK48275.1	1.84e-229	1	692	1	691
ADK14040.1	4.12e-177	1	678	1	683
AQS07142.1	6.13e-175	1	691	1	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSP_A	2.02e-16	3	234	56	285	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	4.42e-16	3	234	56	285	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31986	2.42e-15	3	234	56	285	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	2.42e-15	3	234	56	285	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
P42460	1.08e-09	4	225	11	233	TPR repeat-containing protein Synpcc7942_0270 OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=Synpcc7942_0270 PE=4 SV=1
P44029	4.18e-06	3	88	4	85	Uncharacterized glycosyltransferase HI_0653 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0653 PE=3 SV=1
Q9XC90	4.33e-06	3	88	5	85	Lipopolysaccharide core biosynthesis glycosyltransferase WaaE OS=Klebsiella pneumoniae OX=573 GN=waaE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000125_02211.