CAZyme Information: MGYG000000125_02147

Basic Information

• Species: Clostridium_B tyrobutyricum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_B; Clostridium_B tyrobutyricum
• CAZyme ID: MGYG000000125_02147
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000000125_11|CGC1	28442.25	9.6409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000125	3256597	Isolate	Canada	North America

• Gene Location: Start: 19673; End: 20443 Strand: -

Full Sequence      

MNFRKIRPVLFAAILSTMCVTQVHAASYKVKSGDSLFKIGTLFKNSVDSLVKSNNLKSTE
IYPNQILKVDSKVYTVQASDSLYLISKKYNISVDTLKASNSDVGNYIYPGQVLNIPSGHI
LNGTSYSNSSQPVVPYNSSDLDLLARLVNAEAQSEPYTAKVGVAAVVINRIHNSNFPSTI
KDVIYQKSDKYYQFTPVENGWINKAASEDSKKAAYEALYGSDPTKGAIYYFDDSTTNKWL
WSRTIALRSGKMVFTY

Enzyme Prediction     

No EC number prediction in MGYG000000125_02147.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07486	Hydrolase_2	3.04e-37	154	254	1	100	Cell Wall Hydrolase. These enzymes have been implicated in cell wall hydrolysis, most extensively in Bacillus subtilis. For instance Bacillus subtilis steB is expressed during sporulation as an inactive form and then deposited on the cell outer cortex. During germination the the enzyme is activated and hydrolyzes the cortex. A similar role is carried out by the partially redundant Bacillus subtilis CwlJ. It is not clear whether these enzymes are amidases or peptidases.
COG3773	CwlJ	3.24e-33	126	254	104	240	Cell wall hydrolase CwlJ, involved in spore germination [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.04e-16	21	139	401	546	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.56e-16	24	139	329	469	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.94e-15	21	115	475	591	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND85449.1	1.91e-137	1	256	1	256
QNB65643.1	1.91e-137	1	256	1	256
ANP69996.1	1.91e-137	1	256	1	256
APM38044.1	1.21e-97	1	256	1	253
EDK32721.1	8.02e-96	1	256	1	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F55_A	5.64e-26	136	254	11	126	CrystalStructure of the Catalytic Domain of the Bacillus cereus SleB Protein [Bacillus cereus ATCC 14579]
4FET_A	8.93e-24	136	254	105	220	Catalyticdomain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis],4FET_B Catalytic domain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3V0	7.27e-24	136	254	142	257	Spore cortex-lytic enzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=sleB PE=1 SV=1
P0A3V1	7.27e-24	136	254	142	257	Spore cortex-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleB PE=1 SV=1
Q9KCE0	1.24e-22	136	254	213	328	Spore cortex-lytic enzyme OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=sleB PE=3 SV=1
O31685	5.23e-22	136	254	91	206	Uncharacterized protein YkvT OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvT PE=2 SV=1
P59105	1.02e-20	117	254	143	274	Spore cortex-lytic enzyme OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=sleB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000466	0.668612	0.330210	0.000242	0.000253	0.000211

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000125_02147.