CAZyme Information: MGYG000000124_03904

Basic Information

• Species: Citrobacter youngae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter youngae
• CAZyme ID: MGYG000000124_03904
• CAZy Family: GT4
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		41523.94	9.3352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000124	5038075	Isolate	Canada	North America

• Gene Location: Start: 347072; End: 348184 Strand: +

Full Sequence      

MSKKITVFGTRGIPDVLGGVETHCQNLYPAIKQQFDVDICVIARSPYVSYKRSSYKKVET
YALWAPKKRSLEAIVHSVLAAFRTCVDRSDIVHVHAIGPGLVIPLLRVLGKKVVFTHHGP
DYDRQKWGFVAKKILLLGERWAVRYANEVIVISEVINQLIQKKHARYDAHLIFNGVNKPR
PLSDQTLHATLSRFGLEAKNYFVVVGRFVEEKGMHDAISAYKQSGLQQPLVLIGDADHPT
EYSIRLKQLAADTPGVVMTGFLRGDELQAVFSQARLFVMPSYHEGLPIALLEAMSYSLPA
VVSDIPANLEVQLPSETYFRVGSLSSLAEKLTAWASANSVDYRVYLQNYDWQEIARKTVN
VYHSIDKDIG

Enzyme Prediction     

No EC number prediction in MGYG000000124_03904.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	197	337	5e-25	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.96e-48	4	363	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.97e-37	3	368	1	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	1.13e-33	4	360	1	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd04955	GT4-like	2.14e-31	4	355	1	371	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.
cd03808	GT4_CapM-like	4.69e-29	90	369	83	354	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI40537.1	1.27e-270	1	370	1	370
AMH15603.1	1.27e-270	1	370	1	370
AYL62606.1	1.27e-270	1	370	1	370
ATX04321.1	7.57e-247	1	370	1	370
AUT95970.1	3.08e-246	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZE7_A	1.58e-06	152	311	130	294	UDPGlucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - apo form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZE7_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - apo form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZES_A UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP complex [Synechococcus elongatus PCC 7942 = FACHB-805],5ZES_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP complex [Synechococcus elongatus PCC 7942 = FACHB-805],5ZFK_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP-BH2 complex [Synechococcus elongatus PCC 7942 = FACHB-805]
5ZER_A	1.58e-06	152	311	130	294	UDPGlucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - BH2 complex form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZER_B UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - BH2 complex form [Synechococcus elongatus PCC 7942 = FACHB-805],5ZFK_A UDP Glucose alpha tetrahydrobiopterin glycosyltransferase from Synechococcus species PCC 7942 - UDP-BH2 complex [Synechococcus elongatus PCC 7942 = FACHB-805]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32272	1.73e-10	52	305	75	316	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1
P26402	3.65e-09	103	311	101	296	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
B2SUK8	9.58e-09	77	364	79	368	GDP-mannose:cellobiosyl-diphosphopolyprenol alpha-mannosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) OX=360094 GN=gumH PE=3 SV=1
Q56774	9.58e-09	74	364	76	368	GDP-mannose:cellobiosyl-diphosphopolyprenol alpha-mannosyltransferase OS=Xanthomonas campestris OX=339 GN=gumH PE=1 SV=1
Q65CC7	3.08e-08	92	305	88	315	Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000124_03904.