CAZyme Information: MGYG000000115_00706

Basic Information

• Species: Clostridium_J sp902363375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J sp902363375
• CAZyme ID: MGYG000000115_00706
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000000115_1|CGC8	27993.36	8.7994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000115	3522150	Isolate	Canada	North America

• Gene Location: Start: 767417; End: 768145 Strand: +

Full Sequence      

MIIPKVIHYCWFGRNPLPPSAKKCIDSWKKYCPDYEIIEWNEDNFDINSNKYVKEAYEAK
KYAFVTDYVRLYALYNYGGIYMDTDVEVLKPLDEFLGNKAFSGFETIDTVPTGIMACEKE
HAFFKELLSYYISRNFIKDDGSYDLTTNVTTITNHCIQAGLKLNNTLQTVAGFTLYPKKY
FCPKDHLSGNIHITPETYTIHHFAGSWVSKKDKIKNKIIRLLGTKITEVIVKFKRLIKGG
VK

Enzyme Prediction     

No EC number prediction in MGYG000000115_00706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	97	3e-28	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.86e-24	3	125	82	208	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	6.60e-20	18	101	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.20e-16	3	135	46	195	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	5.10e-06	42	105	140	211	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
NF033479	Efa1_rel_toxin	3.76e-04	48	101	470	529	LifA/Efa1-related large cytotoxin. Members of this family are large and almost certainly multifunctional proteins found in various pathogens from genus Chlamydia, about 3000 amino acids in size and related to lymphostatin (Efa1/LifA) from enteropathogenic Escherichia coli. Roles have been suggested for Efa1 (EHEC factor for adherence) in adhesion, so some members have been annotated as adherence proteins rather than cytotoxins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR65866.1	1.28e-101	2	233	1	232
QUT95860.1	3.26e-98	2	227	1	222
BBK91625.1	4.84e-97	2	242	1	245
AST53065.1	5.35e-97	2	227	1	222
AIQ37491.1	5.67e-96	2	236	1	241

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	3.39e-09	3	128	57	185	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
O14084	3.65e-07	3	101	64	168	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
P38287	3.28e-06	2	128	61	190	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q9UT67	5.60e-06	2	135	81	216	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000115_00706.