CAZyme Information: MGYG000000112_02441

Basic Information

• Species: Actinomyces sp900323545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp900323545
• CAZyme ID: MGYG000000112_02441
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000000112_3|CGC4	34118.26	4.6583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000112	3112947	Isolate	Canada	North America

• Gene Location: Start: 590960; End: 591970 Strand: -

Full Sequence      

MGRHSQTSSLSTTLSGLGSLATKKRTATGVHGRRRAEGPAKTALAPMLFKAGGAAAAFSL
AVSGAAYAAISAGDDEGRSSSGGSFGLIGGESEAKPQATEAQGSGKIASAQVSTTTVDEP
QVHGTVQKESDALPAGQTQVETPGVDGLVRTTYEVTTADGKEVSRTPVAQVVVTQKVDEV
VLVGTGAQQAQQDAAAQQQAAEAAAAQQQAAQQQASEGSAAPSAPAPAAAPGAGTDPDSA
KAIARSMMAGYGWDDSQFSCLESLWTRESSWNYQAENASSGAYGIPQALPGSKMSEVADD
WTTNPTTQITWGLGYISGRYGSPCSAWAHSESVGWY

Enzyme Prediction     

No EC number prediction in MGYG000000112_02441.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07501	G5	2.14e-21	112	185	1	74	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	2.03e-13	114	185	212	283	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI18256.1	1.87e-185	1	336	1	331
QQC21020.1	1.03e-179	1	336	1	338
QCT34053.1	6.65e-176	1	336	1	348
AMD99065.1	5.42e-174	1	336	1	334
QLF54303.1	7.75e-170	1	336	1	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999571	0.000432	0.000001	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000112_02441.