CAZyme Information: MGYG000000112_00913

Basic Information

• Species: Actinomyces sp900323545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp900323545
• CAZyme ID: MGYG000000112_00913
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000000112_1|CGC13	38102.22	11.4525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000112	3112947	Isolate	Canada	North America

• Gene Location: Start: 1078778; End: 1079845 Strand: -

Full Sequence      

MTRLVRRPTARVVIVNWRQAELTIRAARSITAQLGGGDTLVVVDNASGDDSVERLSRAGL
TVVQSSRNLGFGAGVNLGAQGMSEDVLVLLNNDAIAEPGFLEAIVAPLSEPPAAPSAPST
SAQRTSPRATPGSAPAAATARILLAGRWKPAVPGQDALVSPHTGRWTRISNEAAARGEGE
VLVNSTGNLVDASGNGYDRDWLVPAEREHSPSQVFGLCGGACAIRREAWRTLGGFREDLF
MYYEDTDLSWRLREHGWRVVYVREAVVRHEHASSAGTDSPMFIRVNTRNRILVAAAHSPA
RVVLQALARTLVRGLCGPRRGPVMTGLAQAVAGLPSELWRRSGAPSRRPKPSRRR

Enzyme Prediction     

No EC number prediction in MGYG000000112_00913.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	11	290	1.7e-19	0.9608695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	2.45e-42	12	315	7	265	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.11e-38	12	271	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	6.18e-15	28	267	75	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd02526	GT2_RfbF_like	5.20e-14	28	270	15	204	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	4.50e-12	12	114	2	109	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI16116.1	2.80e-194	1	355	1	359
QQC21446.1	1.84e-193	1	349	1	349
BAV84844.1	7.81e-183	1	342	1	325
AMD99325.1	3.17e-182	1	341	1	324
QCT33769.1	1.93e-180	1	348	1	331

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	8.05e-10	197	298	168	265	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	8.05e-10	197	298	168	265	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000112_00913.