CAZyme Information: MGYG000000110_03463

Basic Information

• Species: Kluyvera sp902363335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera sp902363335
• CAZyme ID: MGYG000000110_03463
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	MGYG000000110_6|CGC8	80168.11	6.8983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000110	4775474	Isolate	Canada	North America

• Gene Location: Start: 313492; End: 315654 Strand: -

Full Sequence      

MTTNPSVMLSVEEEKKILARIRDPQFPARDINVRDCGAVGDGTTLDTDAIQRAINEAHAL
GGGRVVIPSGRFLTGSLELLSHVNLHLQNRDSVLLFTTQTTEAHYPLAYGHWECSPLWNY
RALIYAHGADNIALTGHGVLDGQASESVWWHWTHQIEHAWSTHAQNLQRAGSLRLREMNQ
SGVPVSERRFGDGFYLRPMFIQTLHCQNVLLEGVTLRNSPMWQVNPVMCRNVTVRAMTLR
SHGHNNDGVDPESCCDVLIEDNLFDSGDDCIAIKSGRDRDGREANIPCENIIIRNNRFAD
GHGGIALGSEMSGGIRNVFAVGNEFDSPALTYPLRLKANALRGGIIENVWLRHSRVKRVR
DAVVHATMNYAEGIYGDHLPRFRNIVIEDLQASGGEYGLFIEGLPQSPIDGLVLKDIHIT
DVENPLHAAHWGSGVQMENVTINGLAYPRPIQLFIRGLPQAGDYLRASARLPGNDEAPLD
YCWWIGKTADGPMAALAEGDILALTPTMAGRFVRCEVKYGDMHLVSKAWKIQPESSIQLE
NGESVNTGILRARGIVSAESGGECITRFELAQMVIRLWGLQYHSSSGLEIADVPTNSVWY
PAIDALIRRGMMALQQGKFLPERPIRREEAATVAMMSCGVSYRNASTMLKSTFTDGRILR
DIYLTNAQRAVAFGFLSCDDGGRFHPRRYLRRHEALEMMRAISHFVGDQDTPDKRIKRLR

Enzyme Prediction     

No EC number prediction in MGYG000000110_03463.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	60	424	4.1e-69	0.9138461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.62e-87	12	349	64	388	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	2.97e-16	198	444	85	305	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	8.81e-11	31	309	24	239	Probable polygalacturonase At3g15720
pfam12708	Pectate_lyase_3	1.05e-10	31	85	2	58	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
PLN02793	PLN02793	1.30e-10	29	309	51	278	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH40580.1	0.0	1	720	1	720
QGH31598.1	0.0	1	720	1	720
QIR29034.1	0.0	1	720	1	720
BBT72723.1	0.0	1	720	1	720
BBR22653.1	0.0	1	720	1	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.54e-106	9	457	6	443	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	2.71e-66	26	441	40	447	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	7.19e-28	31	372	157	503	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4MXN_A	1.94e-13	26	264	17	214	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
4MR0_A	1.91e-07	3	94	83	181	Crystalstructure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6],4MR0_B Crystal structure of PfbA, a surface adhesin of Streptococcus pneumoniae [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	2.18e-46	28	419	60	424	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	2.61e-23	31	372	152	496	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P27644	4.20e-21	201	429	25	239	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9LW07	2.51e-10	31	309	24	239	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q8RY29	9.48e-10	31	419	68	408	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000110_03463.