CAZyme Information: MGYG000000110_03390

Basic Information

• Species: Kluyvera sp902363335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera sp902363335
• CAZyme ID: MGYG000000110_03390
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177	MGYG000000110_6|CGC6	19890.49	4.8394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000110	4775474	Isolate	Canada	North America

• Gene Location: Start: 239977; End: 240510 Strand: +

Full Sequence      

MNPIIDGIIVMEGGYTQNAKDRGGKTNWGITEAVARAHGYSGDMRDLTHIEAYAILEEDY
WIKPGFEQVATLSNPIAFELCDAAVNIGAHYPCVWLQRWLNVLNQEARTYSDICTDGHIG
PKTLAALDTYLTWRGKEGEAILVKALNCSQGVYYLDITEKNKNNEEFIYGWIKNRVA

Enzyme Prediction     

No EC number prediction in MGYG000000110_03390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	5	88	6.7e-27	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3926	ZliS	6.84e-61	1	177	5	173	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	2.78e-30	4	88	6	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam05838	Glyco_hydro_108	2.35e-29	5	88	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
pfam09374	PG_binding_3	2.88e-25	91	176	1	76	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH40515.1	8.96e-111	1	177	1	177
QGH31533.1	8.96e-111	1	177	1	177
VDZ84886.1	8.96e-111	1	177	1	177
QLO38776.1	1.00e-107	1	177	1	177
QLT78296.1	1.00e-107	1	177	1	177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6V3Z_A	1.11e-66	4	176	25	197	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]
6V40_A	8.47e-66	4	176	23	195	ChainA, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_B Chain B, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_C Chain C, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_D Chain D, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi]
2IS5_A	3.14e-16	2	177	7	156	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	3.20e-16	2	177	6	155	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]
7DNP_A	5.47e-06	12	127	17	122	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000110_03390.