CAZyme Information: MGYG000000110_00447

Basic Information

• Species: Kluyvera sp902363335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera sp902363335
• CAZyme ID: MGYG000000110_00447
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
160	MGYG000000110_1|CGC11	18281.45	10.4843

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000110	4775474	Isolate	Canada	North America

• Gene Location: Start: 451978; End: 452460 Strand: +

Full Sequence      

MKLIMAVVLTVPFIRHVHADCWDFTAKRFNIEVRLLQSIAQVESRMDPASIGKNRNGTRD
YGLMQINSIHLSRLSKKGISESMLVNDPCVSLLVGASILKDMVNIYGYGWEAVGAYNAGA
AKGRYSMRMKYARQVWQIYQRPVGERIKIPLQEFHRRIPL

Enzyme Prediction     

No EC number prediction in MGYG000000110_00447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	30	146	1e-20	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	3.56e-63	1	141	1	141	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	2.10e-51	29	141	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.77e-23	22	121	1	97	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	7.32e-22	2	139	3	142	lytic transglycosylase; Provisional
COG0741	MltE	9.58e-12	25	129	146	250	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIR27151.1	7.36e-104	1	160	1	160
QIX96582.1	1.17e-66	1	160	1	160
AKG72623.1	1.96e-52	18	139	18	139
ANI31719.1	9.03e-52	18	141	11	134
QJU42329.1	1.99e-51	18	139	24	145

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.04e-14	20	103	2	86	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	3.09e-48	19	144	19	144	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	3.09e-48	19	144	19	144	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	2.51e-47	19	141	19	141	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	5.59e-37	13	145	11	144	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	4.52e-36	19	145	18	144	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000229	0.999167	0.000154	0.000151	0.000140	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000110_00447.