CAZyme Information: MGYG000000109_01169

Basic Information

• Species: Streptococcus sp004166885
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp004166885
• CAZyme ID: MGYG000000109_01169
• CAZy Family: GH20
• CAZyme Description: Beta-N-acetylhexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1186	MGYG000000109_1|CGC16	130185.63	4.4722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000109	2017268	Isolate	Canada	North America

• Gene Location: Start: 1190812; End: 1194372 Strand: -

Full Sequence      

MKSHQPRYAIRKYAVGVASVLVGFFASGQVVAADTPSVTESPATTPPTQPSEGDLPQSAT
EETAQPAVEKPIVPAPIVEQSQPTLPDRELRASDLDRLIREEAISVTEANGTAQPVTAAT
ETPAKDPEQEEKLAKKKVISIDAGRKYFSPDQIKEIIDEASKTGYTDLHLLVGNDGLRFV
LDDMSLQVGDASYSSQAVKEAVEKGTKAYYDDPNGTALTQAQMDDILAYAKSKKIGVIPT
INSPGHMDAILTAMDQLGIENPHFNYFGTKKSERTVDLDNQKALDFTKALVDKYAAYFSG
KTEIFNIGLDEYANDATDAHGWQVLQASKHWPDEGYPDKGYEKFIQYANDLAAIVKKHKM
KPMAFNDGIYYNGDTSYGTFDKDIIVSYWTGGWNGYDVASSKFLSELGHQILNTNDAWYY
VLSRDKAGSGWYNLDQGLEGISKSAIDIVQKNDGAKVPFIGGMVAAWADTPSATYKKELL
FKLMHAFADKNADYFVADPEVVEKALAEAPTDLDHYTPDSLVAFTAAKNALEGVGAETTR
AEAKELIASLKAAQESLVYTESYAKELADKEAAEKLAKSKVISIDAGRKYFSLDQLKRIV
DKASELGYSDLHLLVGNDGMRFVLDDMTVEANGKTYASDDVKQALLEGTKAYYDDPNGQA
LTQAEMDELLAYATSKGIGLIPAVNSPGHMDAILVAMEKLGIEHPQATFDTVSKTTMDLT
NEEAVNFTKALIGKYMDYFKGKSKIFNYGTDEYANDATNAQGWYYLKWYELYGKFADYSN
SLAAMAREKSLQPMAFNDGFYYGDEDDVTFDKDVLISYWSKGWWGYNLASPQYLADKGYK
FLNTNGDWYYVLGHRGDQSYPLDKALQHSETVPFEQLASTKYPDVKLPVSGSMLGIWADE
PANEYKEEEVFQVMEAFANHNKDYFKANYTALHAALANVPTDLSIYTEESRSALATVLDQ
LNWKISRANQEKVAEQVEQVTQALSQLKPITQVGSQAEDDVRALVADIPSLEVVEKELDF
EVVERTNPDLAKGERKVVQVGVKGQQREFVAVSTLDESRQVVGTEVSKEAVAEIVEVGTK
EAEVITPTPGLQNGPSPQPDLPQVDQGGHLQVRPIVSEVKPLVNAQPAPVASEQKTVEEA
QPAPVQDQTPSSHQLPQTGQESVLGLALLGAILGATGMSLKGRKED

Enzyme Prediction     

EC	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	139	489	3.4e-53	0.9287833827893175
GH20	582	919	1.5e-49	0.9287833827893175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3525	Chb	3.01e-165	132	911	9	730	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06564	GH20_DspB_LnbB-like	1.14e-100	578	924	1	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	3.31e-97	135	494	1	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
COG3525	Chb	7.42e-34	105	483	391	732	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd02742	GH20_hexosaminidase	1.95e-28	139	490	4	300	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH65722.1	0.0	1	1186	1	1186
AMP67728.1	0.0	1	1186	1	1188
VED66574.1	0.0	1	1186	1	1188
VEE18570.1	0.0	1	1186	1	1188
AGY37538.1	0.0	1	1186	1	1186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AZI_A	3.36e-218	574	1009	5	442	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZI_B Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
2YL5_A	5.32e-217	574	1009	5	442	Inhibitionof the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],2YL5_B Inhibition of the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],2YL5_C Inhibition of the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],2YL5_D Inhibition of the pneumococcal virulence factor StrH and molecular insights into N-glycan recognition and hydrolysis [Streptococcus pneumoniae TIGR4],4AZC_B Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZC_C Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZC_D Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
4AZG_A	5.52e-217	574	1009	6	443	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZG_B Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZH_A Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZH_B Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZH_C Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4],4AZH_D Differential inhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]
2YLA_A	1.50e-216	574	1009	5	442	InhibitionOf The Pneumococcal Virulence Factor Strh And Molecular Insights Into N-Glycan Recognition And Hydrolysis [Streptococcus pneumoniae TIGR4],2YLA_B Inhibition Of The Pneumococcal Virulence Factor Strh And Molecular Insights Into N-Glycan Recognition And Hydrolysis [Streptococcus pneumoniae TIGR4],2YLA_C Inhibition Of The Pneumococcal Virulence Factor Strh And Molecular Insights Into N-Glycan Recognition And Hydrolysis [Streptococcus pneumoniae TIGR4],2YLA_D Inhibition Of The Pneumococcal Virulence Factor Strh And Molecular Insights Into N-Glycan Recognition And Hydrolysis [Streptococcus pneumoniae TIGR4]
4AZC_A	4.22e-216	574	1009	5	442	Differentialinhibition of the tandem GH20 catalytic modules in the pneumococcal exo-beta-D-N-acetylglucosaminidase, StrH [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49610	0.0	5	1078	6	1135	Beta-N-acetylhexosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=strH PE=1 SV=2
B2UPR7	2.83e-06	584	900	239	539	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000889	0.997871	0.000675	0.000208	0.000182	0.000156

TMHMM  Annotations     

start	end
13	32