CAZyme Information: MGYG000000107_01879

Basic Information

• Species: Klebsiella_A oxytoca
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A oxytoca
• CAZyme ID: MGYG000000107_01879
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000000107_2|CGC5	52919.96	6.0212

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000107	5859765	Isolate	Canada	North America

• Gene Location: Start: 321077; End: 322477 Strand: +

Full Sequence      

MSLPSRLPAILQAVMQGQPRALADSHYPRWHHAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHKFKCWGHWSSADLLHWQHEPMALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FADGGRTAWQCLATENADGTFRKIGPVLPLPEGYTGHVRDPKVWRHEGRWYMVLGAQDRQ
KRGKVLLFSSADLHQWTSKGEIAGYGLNGLDDAGYMWECPDLFPLGDQHILICCPQGMAR
EEERFLNTYPAVWMAGGFDYDRAAFSHRELHELDAGFEFYAPQTMHTRDGRRLLVGWMGV
PDGEEMLQPTLANGWIHQMTCLRELELIDGQLYQRPLRELTALRGEAHGWPGNALPLAPM
EIALQTARDDALSLDFGGALTLERDTRGIRLARRNLAGDEMHYRYWRGEVRSLRIFIDRS
SVEIFINDGEGVMSSRCFPAYPAQLIFSGSAPDAFCYWPLRTCMVE

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	336	5.7e-97	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	0.0	14	440	1	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd18623	GH32_ScrB-like	3.36e-163	37	329	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	2.16e-160	24	462	26	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.42e-141	31	429	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	3.28e-137	31	336	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDY51079.1	0.0	1	466	1	466
AWF35851.1	0.0	1	466	1	466
AVL81436.1	0.0	1	466	1	466
QSS39028.1	0.0	1	466	1	466
AYZ54338.1	0.0	1	466	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	2.16e-87	12	447	12	467	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	5.91e-75	12	446	18	470	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	8.10e-75	28	438	50	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.23e-73	28	438	50	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	6.58e-56	28	428	4	396	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37075	0.0	1	466	1	466	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	7.47e-292	1	466	1	466	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P07819	7.99e-130	12	451	14	465	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
A5EZZ8	7.23e-104	6	458	66	532	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=cscA PE=3 SV=1
Q9KLT6	7.65e-104	21	458	88	532	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=VC_A0655 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000107_01879.