CAZyme Information: MGYG000000105_00760

Basic Information

• Species: Bacteroides clarus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides clarus
• CAZyme ID: MGYG000000105_00760
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000000105_1|CGC11	42326.12	8.0228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000105	3966085	Isolate	Canada	North America

• Gene Location: Start: 805616; End: 806779 Strand: -

Full Sequence      

MHILKNLFIVVFLSFLFSIKGEAQTTEQSDFSGLKKCTVFSAGDDNVNSYRIPSLLTTKD
GTLLVFCEARRDSWRDKSRTDIVVKRSEDTGKTWSVMQDLTQGITGAYMDPTPILDSITG
RIFLFTTFWPSEDHSGTKNRAILITSDDNGKTWSSPVDVTSTIIPAGYHIVGFGPGAGLQ
MSGKQFKERLVLPTRVVDSERKSAHNVAIYSDNHGRTWTMGGKGDTGDEFQIAESPAGTL
VYNARIPGARMVAYSADGGGTWSKAVKEPALPGVSKGCQASVLGQGRQLYFSGIRGKAET
PEYDERVGLALYKSCDGGKTWNDGIQLYDEASGYSCMSFLPDGRMAIIFETADTPGFTRK
SLPGIKPLKRPAGWMRLDLLILPIINL

Enzyme Prediction     

No EC number prediction in MGYG000000105_00760.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	39	354	1.5e-81	0.935672514619883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.95e-91	38	356	2	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.78e-25	61	335	1	266	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	2.29e-13	9	374	239	669	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13859	BNR_3	1.63e-11	52	284	1	234	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	7.04e-05	84	220	3	111	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95628.1	5.69e-216	1	387	1	387
QUR43338.1	3.14e-206	1	387	1	387
SEH77633.1	7.16e-97	38	381	69	403
QUR43337.1	2.44e-73	38	382	62	422
QIU95629.1	4.60e-73	38	382	60	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MHU_A	4.69e-75	38	382	38	398	ChainA, Exo-alpha-sialidase [Bacteroides acidifaciens],7MHU_B Chain B, Exo-alpha-sialidase [Bacteroides acidifaciens]
6MNJ_A	2.18e-29	42	352	192	523	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
6MYV_A	1.19e-28	42	352	173	506	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	1.42e-28	42	352	194	527	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4FJ6_A	6.39e-27	39	352	170	506	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	1.10e-30	42	352	195	528	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P15698	1.45e-25	35	350	37	380	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
Q02834	3.41e-25	43	350	60	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P29767	1.05e-20	39	366	384	827	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P10481	2.11e-20	46	350	32	362	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999080	0.000200	0.000160	0.000155	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000105_00760.