CAZyme Information: MGYG000000102_00566

Basic Information

• Species: Terrisporobacter sp902363255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter sp902363255
• CAZyme ID: MGYG000000102_00566
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000000102_1|CGC7	54823.06	4.9511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000102	3838773	Isolate	Canada	North America

• Gene Location: Start: 588618; End: 590045 Strand: +

Full Sequence      

MAFRKDFLWGGATAANQCEGGYKEGGRGLSNVDVQPFGKDRFPVGMGKMKMFECDEEHYY
PSHTAIDMYHHYKEDIALFAEMGFKCYRLSIAWTRIFPTGEEKTPNEEGLKFYEDLFDEC
LKYGIEPLVTICHFDVPMHLVEKYGSWRSRELVDLYVRYCEAIFTRFKDKVKYWLTFNEI
NMLLHLPFVGAGLYFEEGDNEEEVKYQAAHHQLVASALATKLAHEINPEFKIGCMLAAGN
TYANTCAPEDVFKSMEKDRENYFFIDVQSRGYYPAYALKELERKGIEIKMEEEDEKILRE
NTVDFISFSYYSSRLTSADPEVNAETEGNVFATLKNPYLKASEWGWQIDPLGLRITMNSL
YDRYQKPLFIVENGLGAVDTPDKNGEINDDYRIEYLRQHIKAMKDAVELDGVDLLGYTSW
GCIDLISASTGEMKKRYGYIYVDKDNDGSGTLKRSKKKSFHWYKKVIATNGEDLA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	471	1.4e-151	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	474	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	475	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	5	474	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	473	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	474	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGD88872.1	0.0	1	474	1	474
QIF77575.1	0.0	1	474	1	474
AVD42908.1	0.0	1	474	1	474
QQY54163.1	0.0	1	474	1	474
QQY47508.1	0.0	1	474	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	8.28e-220	3	474	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	4.65e-200	1	474	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	9.90e-195	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.82e-194	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.76e-190	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	3.41e-234	3	474	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	3.50e-216	3	474	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	2.55e-199	1	474	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	3.90e-197	1	474	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	1.21e-192	5	474	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000102_00566.