CAZyme Information: MGYG000000098_00450

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_00450
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000000098_2|CGC1	36039.89	9.4797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 169807; End: 170712 Strand: +

Full Sequence      

MKQIVAIQNGLGNQMFDYAFYLALKRIYPKARITTYLFARRCDHNGLEIDRIFSLPLSEK
KHDRIMMRMYRKLYYLSKKQTFTGIFGRYTLKLLYILHIGLCMEKPEIPYQGAQSYIWNR
KYKVFWGGWMSEKWFLPIKEEIQKCFSFDLQKLSPKSANLLEELSQTGTNSISIHVRRGD
YLKNPQYFDICNTTYYRKAIGLIKEKIDNARFYVFSDDIQWVKENLDLPQNTVYVNWNMK
TDSWQDMCLMSHCQHHIIANSTFSWWGAWLNKNEEKIVICPQIFSRTENLVNVMPDEWIK
I

Enzyme Prediction     

No EC number prediction in MGYG000000098_00450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	4	301	2.6e-68	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	7.01e-62	1	279	1	249	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	7.42e-24	5	273	4	268	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY37044.1	2.86e-71	3	301	2	278
QUT58051.1	2.86e-71	3	301	2	278
ABR40839.1	2.86e-71	3	301	2	278
QEW36700.1	2.86e-71	3	301	2	278
QQY44012.1	2.86e-71	3	301	2	278

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	7.98e-30	7	301	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
P19526	2.39e-12	135	270	174	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1
Q9TUD6	2.41e-12	135	270	175	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Pan troglodytes OX=9598 GN=FUT1 PE=3 SV=1
Q9TUD4	2.41e-12	135	270	175	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=FUT1 PE=3 SV=1
Q866F0	5.90e-12	172	270	216	318	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000098_00450.