CAZyme Information: MGYG000000092_00152

Basic Information

• Species: UBA7160 sp902363135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp902363135
• CAZyme ID: MGYG000000092_00152
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000000092_1|CGC4	72995.63	5.6467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000092	3773903	Isolate	United Kingdom	Europe

• Gene Location: Start: 173011; End: 174924 Strand: +

Full Sequence      

MSMVKGVKGRQVYLRDEELLRRREENKNYLLELGSEHLLLPYLMEAGRCKMSETPEDIHG
GWESPLCELRGHFLGHWLSAAAMHYEATGNEQVRAKAEEIVEELAACQKDNGGQWAASIP
EKYLYWIGQKKPVWAPQYTIHKTFMGLLDMYELAGSKKALDVAVNFGKWFYDWSGKYTEA
QFQEILDVETGGMLEIWVILYRITKDEMFRTLMDRYYRKSLFDGLLAGKDVLTNMHANTT
IPEILGAAAAYEVTGEQRYLDIAQAYWKSAVTDRGSYVTGGQTCGEIWSAPNQLKARLGD
KNQEHCTVYNMMRLADFLFRHTQDPVYLDYWEKNLYNGIMAQGYWQGSFTHGRKSEYPTK
GLLTYFLPLRGGAQKAWASKTQDFFCCHGSLVQANAAHNTGFYYEGENALYVCQYFESDY
EGTIGDTKVSVKLRKNRMNGTEHLSSDSSGTQKISRIAARYPSYPRRQVYDLIVETEKET
AFDIYVRIPAWTAGEGTVCVYNTENADELRAVMEGENPNGEKLSAKPGTLVKLCRSWKRQ
VIHVELPKTLTVEHLPDQEDMAAFLDGPVVLAGLCDEERILHTKGLQENELLVPDNEREW
GNWMGTWKTVRQEQGIRFVPLYQVGYEHYSVYFPVEE

Enzyme Prediction     

No EC number prediction in MGYG000000092_00152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	11	572	1.3e-159	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.41e-93	11	572	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.29e-56	1	622	1	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07470	Glyco_hydro_88	2.30e-04	125	263	16	154	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99157.1	0.0	1	636	1	620
QIB58295.1	0.0	1	636	1	620
QMW77732.1	0.0	1	636	1	620
AIQ41686.1	1.45e-231	7	637	4	619
QHQ63557.1	9.19e-230	4	637	1	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.21e-53	12	633	33	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.31e-49	12	572	33	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000092_00152.