CAZyme Information: MGYG000000079_01260

Basic Information

• Species: Exiguobacterium sp902362975
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium; Exiguobacterium sp902362975
• CAZyme ID: MGYG000000079_01260
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	MGYG000000079_12|CGC2	84740.96	6.199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000079	2825544	Isolate	United Kingdom	Europe

• Gene Location: Start: 35981; End: 38164 Strand: -

Full Sequence      

MTKQPLRILVYGDVNLNLIDGSAIWLTSVVHMLNQDPNIEVDVLLKRSIVKPEVTASIKQ
LDRVRFIDVFAEDSTKKDEPYYEKKVLQPEEAAQLIHELVETKQYDMTFIRGFQLAYALS
DYEHTMKKTWTYLTDFTHDSSAASQEELARLKKIADRSARMLCQTAEMKAYFETFLQTPK
PFLILNPMIPNMRETTPTFKRQAKRLVYTGKFAPLWYSTEILDALEKLRVRMPDVELKVA
GDKFNQDPNNPNFRKEVTHRLLTDEGVHWLKGIPRADVETLIEESDIGISWRHPDLDDSL
ELSTKLLEYGALGKPVLLNRNKMHEMLLGSSYPLFVNSEDEFIEKVELAFTHPAIYKDAA
ERLYNMAKNYTFASTFERLRDAVWEMRKTTILFAGHDLKFIRMFMERFEADPSYRVLVDQ
WDGHKIHDVNHSKACLAQADVIFCEWGLGNAVWYSQHKLPHQRLIVRIHRQEKETPFPRE
YALDNIDRIILVSPYMLEEMHRLFGIPRHQMTVIYNAVDADKLDKPKQADDLTFRLGMIG
MNPKLKRPDLALDVLEELLKTDKRYQLHFKGHHPKDVYWIGKREEESAYYEALLKRIEES
DLRDHVHFDGHGHDVDTWLQSIGFVFSTSDLESFHLAPAEAMAAGSYPLIRHWTGAETIY
PDELLVTDTMEFVDTILSYKEDTEKLMADTKAYQAYARKHFALDRLYREMEQIISGKTHA
QFSTTLS

Enzyme Prediction     

No EC number prediction in MGYG000000079_01260.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.00e-28	404	714	48	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	9.54e-19	440	645	85	286	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	4.08e-17	453	715	123	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03807	GT4_WbnK-like	9.61e-13	499	713	146	360	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
COG0438	RfaB	2.87e-12	7	381	2	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ69993.1	0.0	1	727	1	727
QPI68332.1	0.0	1	727	1	727
QUE87297.1	0.0	5	714	4	711
ACK92434.1	3.06e-228	1	715	1	711
AJH89385.1	3.50e-227	1	715	1	711

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000079_01260.