CAZyme Information: MGYG000000078_00696

Basic Information

• Species: Lachnospira rogosae_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira rogosae_A
• CAZyme ID: MGYG000000078_00696
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000000078_2|CGC4	36672.38	5.1359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000078	3032544	Isolate	United Kingdom	Europe

• Gene Location: Start: 224002; End: 224976 Strand: +

Full Sequence      

MNIYLAGDSIVQNYTEEEFIAGWGQYLKYYVTPDTKVFNCAKGGRSSRLFLNEGRFDKID
ESIQAGDYLLIEFCHNDDSSKGYSTMFNRMTELGIPDEDGRYPVIPGERVPKDYIPKEYI
DALMKDDSIADKEAVLASVKAFNNTYPNDTYYPYSPNGEKGSFKWFIKQYIDMAREHNAV
PVLVTAPARTAFNKDGTIKDGPGLHGGDNFCYIRAMKQIGEETHTPVIDLFSYTVKLFES
IGEADIHKYTSIKKGINKGKWPEDFVNELAKKDTVSENTHFNKYGAWLITKGLVNLIKEC
DNEQVTALKNVIVNSDYKVASPLI

Enzyme Prediction     

No EC number prediction in MGYG000000078_00696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	2	295	1.9e-67	0.9857142857142858

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	4.78e-49	2	289	2	190	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd01834	SGNH_hydrolase_like_2	5.33e-05	148	245	72	168	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd00229	SGNH_hydrolase	0.003	3	77	1	77	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam00657	Lipase_GDSL	0.003	3	85	1	98	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71457.1	3.36e-163	1	315	1	315
QAV09174.1	3.94e-44	1	296	1001	1262
AUO19060.1	1.02e-40	1	299	15	303
ADD61757.1	2.48e-36	1	309	958	1238
QSI02582.1	6.93e-35	1	298	957	1220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	1.10e-12	3	80	3	78	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	1.10e-12	3	80	3	78	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31528	3.29e-22	2	299	4	204	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	1.64e-20	1	299	6	214	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
Q00017	7.49e-12	3	80	20	95	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
Q5BAA2	1.30e-11	3	80	20	90	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000078_00696.