CAZyme Information: MGYG000000078_00090

Basic Information

• Species: Lachnospira rogosae_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira rogosae_A
• CAZyme ID: MGYG000000078_00090
• CAZy Family: GT4
• CAZyme Description: N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000000078_1|CGC2	41322.75	7.5683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000078	3032544	Isolate	United Kingdom	Europe

• Gene Location: Start: 101658; End: 102737 Strand: -

Full Sequence      

MRVLVLANRDFVLYNFRVELLDRLLRDDNEVYICLPNGPKVKYMTEMGCRYIPISIDKRG
TNPFKDAQLIKDYKSIFREVKPDIILTYTTKVCIYAGIVAGNMGIPYLMNVSGLGTAVEQ
PGILQPLMISLYRKAAKKAKCVFFQNEQNREFFIKHKMYSGHYQMIPGSGVNLDKWKYME
YPSDDNGIHFLFVARIIKEKGIEEYLNCAKVIKGKYPNTVFHILGPCDGEYKEILDDYEA
KDLIKYHGEVSDTSEYLKFAHCTIHPSYYPEGISNVLLESEASGRPVITTDRAGCRETVE
DGVTGFCFETRNTQKLIEAVDKFVNMSNADRQQMGKNARLKMEREFDRNIVVEAYLKEM

Enzyme Prediction     

No EC number prediction in MGYG000000078_00090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	186	336	9.4e-30	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	8.14e-112	2	356	1	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	9.24e-40	19	357	22	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.73e-35	19	357	23	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	6.85e-30	18	348	19	348	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam00534	Glycos_transf_1	2.34e-29	190	339	5	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI60147.1	3.51e-138	2	359	4	360
ARD67438.1	1.15e-137	2	359	4	360
QWG41809.1	6.67e-133	2	356	3	355
QQA15831.1	6.67e-133	2	356	3	355
QWI40574.1	6.67e-133	2	356	3	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC2_A	1.55e-13	189	325	320	458	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7MI0_A	9.13e-06	232	357	261	387	ChainA, Glycosyltransferase [Rickettsia africae ESF-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C9	2.37e-22	1	357	1	367	N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglA PE=1 SV=1
P39862	7.47e-14	4	353	9	364	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
Q04975	6.88e-08	79	326	278	541	Vi polysaccharide biosynthesis protein VipC/TviE OS=Salmonella typhi OX=90370 GN=vipC PE=4 SV=2
Q46638	1.25e-06	188	350	224	394	Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora OX=552 GN=amsK PE=3 SV=2
Q9R9N1	1.40e-06	168	357	152	334	Lipopolysaccharide core biosynthesis glycosyltransferase LpsE OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000078_00090.