CAZyme Information: MGYG000000077_00741

Basic Information

• Species: Anaerobutyricum soehngenii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerobutyricum; Anaerobutyricum soehngenii
• CAZyme ID: MGYG000000077_00741
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		39906.89	10.7408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000077	3184592	Isolate	United Kingdom	Europe

• Gene Location: Start: 194901; End: 195983 Strand: -

Full Sequence      

MKNVKVIKKAAIFLMVFVLAFSSLSAAAAVTYKTGNRTVRYRGANYKVYYNSKRVNSVTR
PSLMINGNIMIPYHYTMVKRGPKVSVSKANKGKTITLSANGNRVRFYLNKKYIKVNGKKE
RIRTAPVKAKIGGASLIMLPARVAFEELGFHYTYNKSKKAIYVTGNTTTTNAPASTPIVN
EPAVNTGLQATAFKNMSTQEFINAVGPIAREDYRKTGVLASVTLAQAINESGWGKSGLTQ
NSNNMFGMKTSLSGNSWSGSVWDGRSYVEVKTREEYNGKKVTITAKFRKYPSVAQSIADH
SAYLSNAMNGARRRYDGLTDTKSYFSQLTILQKGGYCTWSGYVSELTTLIKKYDLTKWDN

Enzyme Prediction     

No EC number prediction in MGYG000000077_00741.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	206	355	6.7e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.18e-44	155	360	2	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.77e-33	187	359	149	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	1.27e-23	206	300	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	1.66e-22	168	352	122	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	5.19e-22	197	356	7	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOB71776.1	1.80e-249	1	360	1	360
QUF81465.1	4.72e-196	1	360	1	357
QUF79300.1	2.61e-75	24	359	23	343
SOB71898.1	5.18e-72	39	359	46	343
QQQ98955.1	1.13e-51	187	359	202	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.35e-16	199	359	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.02e-15	155	360	14	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	5.43e-13	196	352	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	7.37e-13	196	352	1	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	7.58e-13	199	350	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.15e-22	199	359	49	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P39046	9.75e-16	154	359	18	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	2.30e-14	155	360	274	473	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9CIT4	5.73e-12	144	359	17	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
Q9I4P4	1.22e-11	197	352	238	384	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000374	0.998895	0.000220	0.000173	0.000164	0.000154

TMHMM  Annotations     

start	end
10	32