CAZyme Information: MGYG000000076_01353

Basic Information

• Species: Roseburia intestinalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia intestinalis
• CAZyme ID: MGYG000000076_01353
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000000076_9|CGC1	38105.37	3.8557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000076	4318260	Isolate	United Kingdom	Europe

• Gene Location: Start: 34226; End: 35320 Strand: +

Full Sequence      

MSITVLNYMDQALVDRIHSQAAKRAETAKQTTSDDFATVLADSTKAIENNQNTISTNTAV
SDTSTVSTGQTAASSASSYTSNELDSIFEDAANTYGVSSIILKSIAKAESGFNPSAVSSA
GAVGIMQLMPSTAAALGVSNSYDARENIMGGAKYISQLLSNYQGNISLALAAYNAGSANV
DKYGGIPPFTETQNYVKKVLSYMEEFGSAVSNTVSSVSDQLSSIFSLTGTARDEANQMLA
DFFSSKNISKDALDILTAILKLKNMISGQTTSTDVSSALQNTDTTSSAVGSTSETPSDRT
AVLTSINSDSETIEDITKDIPVRVIPSAETDTDEDTDTETNTDIDAAVSTDTNDDVSTDT
DSES

Enzyme Prediction     

No EC number prediction in MGYG000000076_01353.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	101	208	3.4e-33	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	4.77e-50	102	204	4	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.31e-42	86	203	8	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.21e-39	85	204	6	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	3.45e-35	88	204	1	157	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	8.39e-31	91	195	4	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV21029.1	2.25e-192	1	334	1	334
CBL11165.1	6.45e-192	1	334	1	334
CBL07423.1	4.39e-163	1	333	1	330
AEN96200.1	1.74e-68	1	264	1	232
QEK19460.1	3.49e-49	82	220	62	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	2.43e-09	92	207	457	593	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.49e-09	92	207	486	622	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	5.71e-09	92	207	457	593	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	5.72e-09	92	207	458	594	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
4OZ9_A	7.85e-08	101	181	276	362	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.02e-42	84	201	60	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.28e-35	63	215	1402	1554	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.28e-35	63	215	1402	1554	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	8.99e-12	95	200	18	116	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q0A9W6	6.72e-11	88	176	296	390	Membrane-bound lytic murein transglycosylase F 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=mltF1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000076_01353.