CAZyme Information: MGYG000000066_03678

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_03678
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	MGYG000000066_38|CGC1	96187.21	4.9664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 19604; End: 22117 Strand: +

Full Sequence      

MMTLNLNGRWKMRAAECEDIWDAVVPGTVAATLLEHGVMPDPFWRDNEKKIQELLDRDYI
FERSFTAGEDLLKQEQIVLHCNGLDTLAEIRLNGAVVGNADNMHRIWFFDVKPFLRPGEN
EISIYFRAPAPYLKEHPSGIGKPYTVLRKAACMFGWDWGLSLPDSGIWRDIMIEGYEKGT
IETVIVHQEHMNGKVIVKAQPVCRGAQDLLFRLTLTEPDGAKLKTRECAAGGTAYFEVEH
PRLWWPSGYGGQPLYRLCTELMTQDMILDTREQRIGLRTIELDRSEDGDGAKYSFVINHI
PVFCRGENMIIENSVIQKTNGSCYKKLIENSLRSNVNSIRVWGGAYYPPEEFYDLCDENG
ILVYQDFMFACSFYQISPEYMENVKQELKDNLARIAHHACIGLYCGNNEIDCIYTVTGAT
DPETTALRKLFGSGKDPLPEAVRKALWANYEPLFLEMIPELCSRYAPDTDYVHSSPSAKA
PGEVTAFFDYAKDGDLHYYLQYNGNAPYQKIRTMRSRFVTEMGFQSYPSMKTIASFTEPQ
DRLPYTPVMYAHQKCAGGNETIELYMERDYLIPKDFEDYVFLSQLQAGEIMRYSVEHFRR
DNEYCRGIMLWQLNDCWPVVSWSGIDYYGRWKALQYFIRRFYAPVLVSAREEDTNVSLWV
SNETAMECNGQLRWKLYGKDGKILDQGEKSAHLSAGESASLVYLDYSRMLNRIEKKSAYL
FFEWEHNGNVERGTVLFVLPREFYFSEPELSWEVKETGSSYVIEVTAKHFAKAVGFDTSE
GDCIFSDNYFDLPAGESRTIEVKKVECEGISDSEDLRRQLMVRTLNDVMRRAAMAGK

Enzyme Prediction     

No EC number prediction in MGYG000000066_03678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	705	1.1e-97	0.6914893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.22e-83	1	801	10	783	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.31e-20	747	827	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	6.97e-13	3	363	12	352	beta-D-glucuronidase; Provisional
PRK10340	ebgA	6.82e-10	60	363	112	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	7.53e-08	207	278	34	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98502.1	1.08e-231	1	832	1	839
AUG59052.1	4.61e-225	2	829	1	818
AIQ75814.1	3.52e-213	1	828	1	821
AWB45455.1	1.55e-208	1	828	1	817
QLG40119.1	1.27e-207	1	828	1	821

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.26e-149	6	800	11	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.33e-149	6	800	13	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.37e-149	6	800	13	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.60e-149	6	800	11	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.48e-147	6	800	11	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D911	3.43e-91	6	803	9	829	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	6.60e-91	6	803	9	829	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.27e-90	6	803	9	829	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1CGA8	1.74e-89	6	803	9	829	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
I2C092	4.04e-89	2	802	5	838	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_03678.