CAZyme Information: MGYG000000066_00587

Basic Information

• Species: GCA-900066755 sp900066755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp900066755
• CAZyme ID: MGYG000000066_00587
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000000066_3|CGC3	88961.19	5.4476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000066	5871603	Isolate	United Kingdom	Europe

• Gene Location: Start: 116622; End: 118955 Strand: -

Full Sequence      

MKFTEGYWEKNERAHMIYAAQAFQIEEIPFGIKITAPTKRIESRADALDTPVITTLITSA
GENILSVCSYHYQGYQRKDPRFPKCLKSIQTKVEDFENETVLTSGRFRVHVDKKEWNLSF
EADGRHLTSCGYHGLGYAQYDREPATMFPEQEYMKAEYRPYMTASLSLNPGACVYGLGER
FTAFVKNGQVVDCWNEDGGTSSQIAYKNIPFYMTNQGYGVFADHADPVSFEVASEKVEEV
GFSVPGEEIRYYLICGKDMKEILEGYTGITGRAALPPAWSFGLWLSTSFTTDYDEETANS
FLKGMKDCGVPVRVFHFDCYWMRALHWCDFVWDPETFPDVPAMLKRYKNQGLKICVWINP
YVAQGTKLFQEGMERGYFLQRADGRGVKQLDNWQPGMGLVDFTNPDAAAWYADQLKGLLQ
LGVDCFKTDFGERIPIDVRYADGSDPMAMHNYYTYLYNRCVYKLLVKEKGEQEAVLFARS
ATAGCQQFPVHWGGDCCATYASMAETLRGGLSFMMSGFSFWSHDMGGFEMTSSPDLYKRW
VQFGLLSTHSRLHGSKSYRVPWLYDQEACEVCREFTQLKYSLMPYLYDCAAYAHETGIPV
MRPMVLEFEEDPATAYLDMQYMLGNKLLVAPIFRENQQALYYLPEGTWTHLLSNERKNGG
RWYQETYDFHSLPLYVRPNSILPIGGRIDRPDYSYLEGLSLHFYQIENEKSACCRITDTD
GKSVFFVQAVYHAGCLKITMSELLKDLRLIIHGIAGPKEQICLVPEEKEVTVRCTFL

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	251	682	1.2e-130	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10658	PRK10658	0.0	1	679	1	665	putative alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	0.0	271	582	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	0.0	8	731	1	717	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.70e-173	252	682	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	2.92e-84	166	661	76	603	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR01836.1	0.0	1	758	1	758
ANU49235.1	0.0	1	758	1	758
AZO95768.1	0.0	1	772	1	783
QTL98631.1	0.0	1	772	1	783
QRT51213.1	0.0	1	759	1	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	5.35e-284	1	754	1	741	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	6.37e-284	1	754	1	741	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	1.54e-270	2	754	2	741	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	7.06e-119	163	684	193	717	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	2.66e-75	175	761	159	772	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	2.83e-283	1	754	1	741	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	6.30e-227	1	701	1	715	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	7.03e-216	1	772	1	762	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	4.36e-74	87	742	80	732	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	3.00e-59	168	749	108	684	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000066_00587.