CAZyme Information: MGYG000000060_02827

Basic Information

• Species: Lachnospira eligens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira eligens_A
• CAZyme ID: MGYG000000060_02827
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		44095.05	4.687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000060	3236509	Isolate	United Kingdom	Europe

• Gene Location: Start: 67192; End: 68337 Strand: +

Full Sequence      

MDAVVKYIDGLLEKSTPDAPVWNIEKIRQGLKSKWNYIDGCMIKAVLQMYDLTKEEKYLK
FADDFIDYRVFEDGTIDGYSIGEKNIDNVNAGKTLFELYDLTGKEKYKKAVDLVYSQIEI
MPRCQNEARSFWHKDIYPNQVWLDGLYMGLPFYLEYETRYNDRKNYSDIFGQFKFVIENM
RNPINGLYFHAMDTSREAFWCDKVTGLSQHSWLRAIGWYTMALIDTLDQVDNKDHKYDAE
CKMLEDAFKDLVDSMLKYQDESGMWYQVVNYGGMDKNYLETSGSSIMAYALLKAVRLGYL
SDDYAQYAKKAIDGICERYLKTKEDGSLSLGGICLVAGLGGNGRRSGTYDYYMSEPIVED
DAKGVGPFLLAYTELLRYENK

Enzyme Prediction     

No EC number prediction in MGYG000000060_02827.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	377	3.7e-111	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.43e-92	31	377	30	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.12e-79	34	378	26	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71682.1	4.62e-274	1	381	1	381
CBL09353.1	3.06e-190	1	379	1	374
VCV21981.1	3.56e-189	1	379	1	374
CBL12002.1	5.05e-189	1	379	1	374
AEN96572.1	7.99e-189	1	377	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.99e-91	31	374	19	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	9.50e-61	33	375	37	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.02e-60	33	375	27	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	4.33e-12	172	315	197	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.95e-10	172	377	198	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.20e-60	33	375	37	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.83e-43	148	376	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.83e-43	148	376	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000060_02827.