CAZyme Information: MGYG000000056_02306

Basic Information

• Species: Muribaculum sp002358615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002358615
• CAZyme ID: MGYG000000056_02306
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000000056_25|CGC1	50121.31	8.5971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000056	3324937	Isolate	United Kingdom	Europe

• Gene Location: Start: 13599; End: 14945 Strand: -

Full Sequence      

MNFQCKLTSASKKVYGAILAGLILCSTLHVNAQNPITINSDNSVTITYIDSKAEKVEVQG
TFFQKGNSLIPMAGMFSKDGKAEMTNTGNGVWSYTSQPLSSELYWYDFVVNEDSVRFDKR
NRDTTRDIGTTYNYFIIKGGIGDNFTDAQTKKGTLKYNWYPSSLNGMSKRRMAVYLPHGY
NSSSRRYPVLYLLHGSGGDETAWDDCGRLSQIMDHLIANGTCEPMIVVMPNGNVELAAAP
GEDPNNPNVQPSGNNVSSMFGKFEKSFVPEIVNYVDKNYRTVTDKQHRAIAGLSLGGLHT
LYTSLNNPNEFDYIGLFSAQTTNALGDKSVGGLKSIGEGWNQLKQALPFLGGGSVDRKIS
SITGGDSDENLDIYDNFDWKLKNFFKKNPRLFYIAVGRDDFTKKLNDDLRKKLNKGGYTF
FYNESDGGHTWSNWRKYLIDYLPRLFKN

Enzyme Prediction     

No EC number prediction in MGYG000000056_02306.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	168	444	1.1e-56	0.9515418502202643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.72e-30	148	447	62	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	9.33e-26	162	445	2	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd11294	E_set_Esterase_like_N	1.54e-15	42	137	1	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2819	YbbA	7.50e-13	162	318	15	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
PRK10439	PRK10439	4.00e-04	280	440	289	401	enterobactin/ferric enterobactin esterase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST54679.1	5.90e-89	17	447	5	389
QUB66231.1	3.27e-88	38	447	35	400
ABR43742.1	3.31e-88	17	447	5	389
QUT21953.1	3.31e-88	17	447	5	389
QUR47296.1	6.59e-88	17	447	5	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	8.86e-68	41	447	30	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	5.09e-34	81	447	67	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	1.35e-30	81	447	44	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	1.95e-30	81	447	65	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6RZO_A	1.17e-22	84	447	48	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	6.85e-24	81	447	357	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	8.48e-19	38	330	43	315	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	4.97e-17	168	319	63	197	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	2.53e-16	68	321	414	656	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	1.26e-09	143	446	817	1075	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001514	0.711424	0.286115	0.000424	0.000267	0.000228

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000056_02306.