CAZyme Information: MGYG000000056_00761

Basic Information

• Species: Muribaculum sp002358615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002358615
• CAZyme ID: MGYG000000056_00761
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000056_4|CGC3	43123.13	5.9266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000056	3324937	Isolate	United Kingdom	Europe

• Gene Location: Start: 124602; End: 125762 Strand: +

Full Sequence      

MKRLFLLTAAVMTAAVVLAQQALWGVPTMISPEVKADNTVTFRLDAPKASSVVVAGDFSP
RGFELMTKDADGIWTYTTPASLAPELYSYTFYVDSLKVSDPNNVYKLRDVSTVSDIFIIG
GQLADLYKVNDVPHGTVSKVWYPCSRTGNDRRMTVYTPAGYEKGDRRYPVLYLLHGMGGD
ENAWTELGRAAQILDNLIARGEAEPMIVVMTNGNVDMQAAPGETSAGLVAPTIQLPHTMD
GTFEEAFPEVVEFVDRNYRTLPSKSARAIAGLSMGGYHSMHISKQYPDMFDYVGLFSAAI
FPDKSKTSPVYADLEAKLKRQFDNAPALYWIAIGDKDFLYEANTEFRKVLDANGYPYTYY
ESPDGHIWKNWRIYLAKFVPQLFKRH

Enzyme Prediction     

No EC number prediction in MGYG000000056_00761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	146	382	6.6e-58	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11294	E_set_Esterase_like_N	3.75e-32	38	120	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	1.76e-29	60	386	1	299	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	4.95e-25	145	372	2	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.40e-17	154	380	38	306	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	2.56e-13	133	300	7	172	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXN65677.1	1.67e-196	1	385	1	397
ALJ59664.1	6.74e-188	1	384	1	393
ADV42548.1	3.66e-186	1	384	1	397
QBJ18653.1	3.10e-185	1	384	1	398
QMI80055.1	1.26e-184	1	384	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	1.03e-107	29	384	22	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.40e-52	25	384	33	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	4.01e-52	32	384	19	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	6.86e-52	32	384	40	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6NE9_A	2.65e-51	27	384	37	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	6.01e-40	26	385	323	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.33e-39	33	384	42	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	4.13e-37	32	384	395	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	1.06e-27	130	379	44	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM38	9.32e-08	139	369	173	428	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.043456	0.954390	0.001336	0.000276	0.000257	0.000275

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000056_00761.