CAZyme Information: MGYG000000056_00297

Basic Information

• Species: Muribaculum sp002358615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002358615
• CAZyme ID: MGYG000000056_00297
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	MGYG000000056_2|CGC1	97235.2	5.4304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000056	3324937	Isolate	United Kingdom	Europe

• Gene Location: Start: 97312; End: 99891 Strand: +

Full Sequence      

MYRYLSYILMPLSIILCHVCCMAQNFCIADTSGASTIFVDADDYAGVIRAARDLGDDVRK
VTGTSAPVLLSRKYNTGGIVVGTIGKSRLIDRMVTRHKLDVSEVKGQWESYVIDVVDGNL
VIAGSDKRGTIYGIYDLSRRMGVSPWYWWADVPVAHRDSVIYDAGRYVQPSPKVKYRGIF
INDEWPSFGGWATKRFGGINSGMYAHMFELLLRLKANYLWPAMWASSFNEDDPLSPSLAD
EYGIVMGTSHHEPMMRAHKEYTKRRDEVGAWNYNTNKSGLDKFFRAGMERNKNFDNIVTI
GMRGDGDVAMSDGGDEANMRTLTEVVNGQRKILSDIYGSPDKVPQLWAVFTEVQRYYDAG
FNVPDDVTLLLCDNNWGYIRRTAPEKERSRKGGVGLYYHIDMNGGPWNDRWVNTSPLPKL
REQLNLAYRSGIDRIWIIRIWIINVGDLKPKEVPIDFIMTYAWEPDSIRPGDEKAYLEHF
AAEAFGPDVAADVADIMAKYPKYNLWRKPEVQRPDILSVENYDEANRVTMMWRQLAEKAE
AVRLRIPVEARDAYYQLVYYPAVASATVAEIYTAAAQNRYYADRGDLRANDFADRAKELF
LKDSLLTVHYNKVMAGGKWDNMMSDKHIGYSRWSMPDNNILPELRYVVESEARQSLPVVE
TPSFEYSVAAIDYSRSKEVEGISWIVLPDLGRGDGCMGGSDVTASVPSTGGAVLEYDLDV
ENADSLRIAIAILPTQDINPGRGLRLGVRLDDGPLQILDARRGFHDVFEEYTPDNLKRAK
NLNPLPAPSTLTLSGYRRPMRNEVFDNRRWLDVNFGITDVGTHTLHVVMIDPEVVVERLV
VNPDDSKYSYFGPPERTAE

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	24	838	3.3e-249	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.06e-176	171	511	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	9.18e-33	667	855	10	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.97e-04	67	137	52	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEC55419.1	0.0	35	856	53	991
QRQ50360.1	0.0	35	856	28	966
QDW23484.1	0.0	24	854	43	983
QRQ59056.1	0.0	34	854	23	976
SCV06546.1	0.0	34	854	52	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	2.14e-196	28	853	16	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.42e-179	24	842	15	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.63e-176	24	842	14	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	2.28e-175	37	851	55	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	3.93e-132	24	648	9	659	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.026903	0.635206	0.336721	0.000413	0.000316	0.000426

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000056_00297.