CAZyme Information: MGYG000000055_01343

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_01343
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000000055_11|CGC3	84323.75	5.0356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 43371; End: 45710 Strand: +

Full Sequence      

MKKIYTALLFSLGITVASYARTEKGAYLDANLPTEQRVADLLSRMTVEEKVGQLLCPLGW
EMYEITGPKSVEVSQKFKDLIQQTEAGMLWATYRADPWTRKTLDNGLTPEQAARAGNAIQ
KYVIENTRFGIPVFLAEEAPHGHMAIGTTVFPTGLGMAATWNPELMHTVGEIIGREVRSQ
GGHISYGPVLDLSRDPRWSRVEETFGEDPLLAGRMGGAMVGGLGGGDLSKPNSTIATLKH
FLAYAVPEGGQNGNYSVVGKRDLLQNFLPPFREAVDSGALSIMSSYNSIDGIPCTSNKEI
LFDVTTDWGFKGFVVSDLYSIEGIHETHHVAPTIEDAAAMALNAGLDVDLGGDAYRNLVS
AARSGKLDSGALDRAVGRVLTLKFEMGLFENPYVKPESARSVGGFRSGEVAREVARQSIT
LLKNEGNLLPLEVRPSMKIALVGPNADNAYNMLGDYTAPQPEGRVVTVLDGLRRQQPGIE
VKYVKGCAVRDTSTADIAAAVRAAREADVVIAVVGGSSARDFKTSYKETGAAVVDATTVS
DMECGEGYDRETLDLLGLQPQLLKALKETGTPLVVVYIEGRPLEKEWAAENADALLTAYY
PGQEGGNAIAEVIFGKYNPAGRLPITVPRSVGQIPVYYNRRAPQLHPYVEGDASPRYPFG
YGLSYTTFDYSGLNLLPGDDGTLTVEATVTNSGDRDGEEVVQLYLHPEYAATVQPLMRLA
DFRRVSIPKGESRKVCFTLPVSAFEIIGPDYKPMLQKGSWDIMVGASSADIRLKGSHVM

Enzyme Prediction     

No EC number prediction in MGYG000000055_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	125	350	6.7e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.28e-175	1	772	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	9.32e-85	128	765	78	769	Probable beta-xylosidase; Provisional
COG1472	BglX	2.42e-78	45	458	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.87e-62	46	382	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	7.65e-61	419	665	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB38145.1	0.0	1	779	1	779
ANU63770.1	0.0	1	779	1	779
QQR08886.1	0.0	1	779	1	779
QNL40717.1	0.0	1	774	2	777
QRN02118.1	0.0	27	774	17	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	3.41e-138	27	772	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	1.08e-137	23	772	3	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	8.37e-137	23	772	3	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	5.15e-128	35	769	4	723	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.82e-127	35	769	4	723	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	4.08e-129	9	772	4	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	4.95e-125	126	774	60	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.52e-124	38	772	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	8.67e-120	1	772	1	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q23892	7.84e-97	38	774	80	821	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000924	0.998195	0.000304	0.000198	0.000184	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_01343.