CAZyme Information: MGYG000000054_03118

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_03118
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	MGYG000000054_46|CGC1	75012.04	5.4671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 9735; End: 11747 Strand: +

Full Sequence      

MKNLFIVFFCLVSALTIKANGQDNLWKIQATDYYGTYFGAAVANGGIGILPWKEPFSVRH
VMLNHVFDAAAPQDVSRVLRGINPFNLQMQIDGQRVSGDNISGWGQCIDMKAATHDTHFT
YGGKADISYSICALRNIPYAGLVRVEVAALEDMYLSVENPIEVPDEYKNPGSKQVSVNVD
GNELKIVRTWALSKYREQKVSASSAFIYDKNPNLQQQSDGTSRISISLKKGEKFSFALLG
SVCTGRDFIDPYNESDREVIYGAKEGLNRLMNGHRKLWNELWEGDIMIEGDDEAQRAVRF
ALYNLYSNARKGSRLSISPFGLSAQGYNGHIFWDTEFWMYPPMLFMNQGIARTMMDYRTD
RLEAACQRALSYGYDGAMFPWESDDAGEESCPTWALTGTFEHHITADIAIAAWNYYCMSG
DKRWLREEGFPLMEKVAEFWVSRVEKNEDGSYSIRNVVCADEYAEGVDDNAFTNGAAMRA
LQDAAKAAVVCGVKAPAIWKEIASKLRLPKFENGVTMEYEGYNGQTIKQADANLLVYPLN
LITRPEEIRKDLEYYEDKIDKTGPAMSFSVLALQYARLGEGDKAYDLFVQSFRPNQLPPF
GVISEGAGGTNPYFVTGAGGLLQTVINGFCGLEVADNGIKQLFSKLPKHWKKLTITGVGP
DRKTYVRMQK

Enzyme Prediction     

No EC number prediction in MGYG000000054_03118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	299	636	6.4e-103	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	1.11e-103	26	653	11	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.52e-68	299	639	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	9.29e-41	221	593	240	654	maltose phosphorylase; Provisional
pfam17389	Bac_rhamnosid6H	2.24e-06	353	594	27	295	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93251.1	0.0	1	670	1	670
QUT79346.1	0.0	1	670	1	669
QDM10252.1	0.0	1	670	1	669
QNL39805.1	0.0	1	670	1	669
CBK67144.1	0.0	1	670	1	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.07e-208	13	666	12	675	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	3.17e-52	221	653	227	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTR_A	2.48e-38	216	658	216	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTP_A	4.45e-38	216	658	216	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	5.95e-36	263	662	286	718	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	2.46e-76	225	659	210	651	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
F1NZI4	7.48e-62	247	659	209	638	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8L163	7.15e-60	22	654	15	733	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
Q32M88	7.52e-59	247	639	199	609	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2
A0JMP0	2.04e-58	235	658	152	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999161	0.000158	0.000148	0.000146	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_03118.