CAZyme Information: MGYG000000054_01783

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_01783
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	MGYG000000054_17|CGC3	84817.54	4.9148

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 37657; End: 39951 Strand: -

Full Sequence      

MKLRNIILMTASVAMTACSKQAVPTAIPEDAKIEQQVEKLLSEMDLDAKIGQMTELAIDV
LGETINGEFQLDEAKLHKAIAEYKVGSFLNAPGPVAQSPEKWNEIIGRIQELSMKEIGIP
CIYGLDQNHGTTYTLGGTLFPQNINMGAAFNPDLTYEAARVTAYETRAGNCPWTYSPTVD
MARDPRWPRVWENYGEDCLVNAIMGSTAVRGFQGDDPNHIPADRIATSVKHYMGYCMPRT
GKDRTPAYISVSELREKHFAPFKACVEAGALTIMVNSGSINGKPVHADRELLTQWLKEDL
GWDGMLITDWADINNLYTREHVAANKKEAIEMAINAGIDMAMEPYDLNYCTLLKELVQEK
RIPMSRIDDAVRRVLRLKFRLGLFDHPNTLLKDYPLFGSKEHALIALHAAEESEVLLKNK
DHILPLPQGKKLLVTGPNANSMRCLNGGWSYSWQGHLTDRFADKYNTIYEAICNKFGAGN
VRLEQGVTYKPEGAYMEENEPEIEKAVAAARNVDIIIACIGENSYCETPGNLSELAISAN
QSKLVKALAATGKPIILILNEGRPRIINELEPLADAVIDILLPGNYGGDALANILAGDVN
PSAKMPYTYPRHEAALTTYDYRVSEEMDKMEGAYDYNAVVSVQWPFGYGLSYTTFEYSNF
QTDKSSFTAGDDLHFSIDVTNTGKYAGKEVVMLFSSDLVASLTPENRRLRAFKKVELQPG
ETQTVTLSIKGSDLAFVNSDGQWVLEQGDFRMQCGNQVLTITYK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	342	1.4e-62	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.81e-142	7	755	9	751	beta-glucosidase BglX.
COG1472	BglX	3.03e-79	44	451	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.46e-65	46	377	2	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.49e-62	108	762	65	776	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.02e-49	415	652	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU59201.1	0.0	1	764	1	764
QQR15881.1	0.0	1	764	1	764
QDH53502.1	0.0	1	764	1	764
QDM10585.1	0.0	1	764	1	764
QUT79171.1	0.0	1	764	1	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	21	761	1	746	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5Z87_A	5.30e-111	112	755	116	771	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.94e-106	34	755	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.04e-105	34	755	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	1.07e-105	34	755	5	720	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	11	761	14	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	2.77e-154	37	759	80	816	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	6.87e-110	37	755	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.01e-108	37	755	38	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	3.14e-98	16	755	16	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000082	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_01783.