CAZyme Information: MGYG000000054_01530

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_01530
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774	MGYG000000054_14|CGC1	86646.94	4.9537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 4713; End: 7037 Strand: -

Full Sequence      

MKKLLTTLLLGSIFSACAERQPVPAIPSDPEIEGKIEKLLKGMTLEEKIGQMCELTIGVV
TDKNNNKLSEALLDTVIGKYKVGSLLNIPFGVSQKKEVFAEVITQIQKKSLEEIGIPCIY
GLDQIHGASYTQDATYFPQGINMAATFNRELARRCAEITAYETRACCVPWTFAPVMDLGR
DPRWPRMWESFGEDTYVNAQMAVQAVRGLQGDNPNKVDEYHISSCIKHFMGYGVPVSGKD
RTPSSITDIDMREKYFAPFKAAIRAGALSLMVNSTNNSGVAFHANKELLTGWLKEDLNWD
GMIVTDWNDINNLYFRDHIASSKKDAVRLAVNAGIDMAMIPSEGQFCIDLKELVEEGAVS
MERIDDAVRRVLRLKFRLGLFENPYWDIRKYDKFGSREFAEVALQAARESEVLLKNEGEL
LPLRKGTKILLAGPNANAMRCLNGGWSYSWQGELADEFAQAYNTIYEALCNKFGTENIIY
EPGVTYVADPNDSWWKENRPEIGKAVAAAGRADVIIACIGENTYCETPGNLNDLNLSSNQ
KELVRALAATGKPVILVLNEGRPRIIHEIEPLAKAVVHIMLPGNYGGDALADLIAGDANF
SGKLPFTYPKFINSLATYDYKPCEQMGTMEGEYNYDAVMDIQWPFGHGLSYTSYEYSNFK
VNRTTFNADDELIFEVDVKNVGERAGKETVLLYSSDLAASVSPDVIRLRYFEKVELQPGE
TKKVVMKLKGSDLAFVGQDRKWRLEQGRFRMKCGSEILYIDCEKDKIWDTPNID

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	339	5.7e-68	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.08e-145	16	754	18	751	beta-glucosidase BglX.
COG1472	BglX	4.57e-88	43	448	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.36e-73	44	374	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	6.02e-65	134	726	111	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.90e-52	412	651	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW16391.1	0.0	1	774	1	774
QRP58900.1	0.0	1	774	1	774
QQT79216.1	0.0	1	774	1	774
QQA09747.1	0.0	1	774	1	774
ASM67365.2	0.0	1	774	1	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	24	772	5	758	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	3.27e-107	28	755	6	739	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.75e-106	28	755	6	739	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	2.45e-101	36	755	13	738	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.24e-99	36	756	7	721	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	1	772	1	780	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	4.24e-149	36	758	80	816	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	3.24e-110	27	760	28	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.24e-109	27	760	28	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	3.52e-101	1	755	1	708	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_01530.