CAZyme Information: MGYG000000054_01453

Basic Information

• Species: Bacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides acidifaciens
• CAZyme ID: MGYG000000054_01453
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000000054_12|CGC2	38257.97	7.6994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000054	5213730	Isolate	United Kingdom	Europe

• Gene Location: Start: 91697; End: 92695 Strand: -

Full Sequence      

MTSWEGMECYNNSPLIYALECKNVAITGTGLLSPKMDCWKKWFARPKAHMDALRKLYTMA
SKDVPVEKRQMAVGENHLRPHLIHFNRCENVLLDSFKIRESPFWTIHMYMCNGGIVRNLD
VKAHGHNNDGIDLEMTRNFLVEDCTFDQGDDAVVIKAGRNRDAWRLNTPTENIVIRNCNI
LEGHTLLGIGSEISGGIRNVYMHDCKAPQSVRRLFFVKTNHRRGAFIENIHMENIRTGHV
QRVLEIDTDVLYQWRELVPTYEERITRIDGIYLKNVICDSADAIYELKGDAKLPVKNVVI
QDVHVDKVNDFVKKVHNVKNVKEDNVTYGLLH

Enzyme Prediction     

EC	3.2.1.67	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	5	324	6.3e-61	0.8153846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.29e-51	3	249	156	407	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	3.87e-11	80	306	85	304	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	2.69e-09	79	205	137	257	Probable polygalacturonase At3g15720
PLN03010	PLN03010	2.43e-08	83	325	160	396	polygalacturonase
PLN02218	PLN02218	6.83e-06	80	305	192	408	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69619.1	1.41e-250	1	331	122	452
ALJ58890.1	8.79e-220	1	329	134	462
QUT89993.1	9.70e-220	1	329	127	455
QUT27372.1	3.17e-202	1	328	128	455
QDH57575.1	9.67e-202	1	328	120	447

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	7.36e-191	2	329	122	449	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	5.15e-61	1	306	102	411	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	6.37e-16	83	244	25	190	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9LW07	8.64e-09	79	205	137	257	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
Q9FY19	9.13e-07	79	303	183	399	Polygalacturonase OS=Juniperus ashei OX=13101 GN=JNA2 PE=1 SV=1
A2QBB4	6.18e-06	79	305	154	413	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
Q2EQQ2	8.23e-06	79	305	154	413	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000088	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000054_01453.