CAZyme Information: MGYG000000053_01082

Basic Information

• Species: Alistipes sp002358415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002358415
• CAZyme ID: MGYG000000053_01082
• CAZy Family: CBM51
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000000053_4|CGC2	53068.6	4.8901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000053	2181722	Isolate	United Kingdom	Europe

• Gene Location: Start: 124352; End: 125800 Strand: -

Full Sequence      

MNSRLLLGGALVAGAAAAPSCSEAPKAKAPRPNILFILADDLGYGDLGCYGQQRFPTPHI
DALAASGMRFTQCYSGTTVSAPSRSCLLTGTHSGHTPIRGNVEQQPEGQFPLPDDAASLF
LGLKQAGYRTGAFGKWGLGFIGSTGDPARQGVDRFYGYNCQLLAHSYYPDHLWSDAERVE
LEDNTDAVPYGQGTYAPDLIHAEALRFLDEQQADEPFLLFYPTTIPHAELIIPEDSIMQR
FRGMYPETPYKGCDSGPGFRHGGYCSQTHPRAAFAAMVTRLDHYVGELVEKLREKGMLEN
TLIVFASDNGPHMEGGADPDFFDSNGILRGYKRDLYEGGIRVPMIAVWPGHIAPGTTTDF
ACAFWDIPFTFADAAGAPAPEGDGVSLMPLLEGREGIQQQHDHLYFEFMELGGRQAVRQG
PWKLLHLGIRSQNPRWELYNIDEDPSEQHDLAAEHPEKVEELRALMVREHVDDPAWPLFG
KK

Enzyme Prediction     

No EC number prediction in MGYG000000053_01082.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16145	ARS_like	0.0	32	456	1	415	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16144	ARS_like	2.46e-126	32	468	1	420	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	1.99e-103	31	452	1	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16146	ARS_like	1.79e-101	32	464	1	399	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16143	ARS_like	9.76e-101	32	452	1	395	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE74880.1	1.04e-106	30	466	38	464
QGL47258.1	5.79e-105	4	473	6	471
ATZ24822.1	1.24e-104	32	466	43	467
AWZ15637.1	3.43e-104	6	466	8	464
QEU79084.1	3.24e-102	33	464	45	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AN1_AAA	4.63e-133	31	474	29	500	ChainAAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482],7OQD_AAA Chain AAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482]
7ANA_AAA	2.10e-132	32	466	30	494	ChainAAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANA_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_AAA Chain AAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482]
7STT_A	2.73e-61	31	466	6	429	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
6PSM_A	5.04e-60	29	481	22	450	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	2.69e-59	29	481	22	450	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15289	3.83e-50	27	467	16	461	Arylsulfatase A OS=Homo sapiens OX=9606 GN=ARSA PE=1 SV=3
P50428	1.87e-46	29	423	17	394	Arylsulfatase A OS=Mus musculus OX=10090 GN=Arsa PE=1 SV=2
Q08DD1	3.66e-46	27	451	16	441	Arylsulfatase A OS=Bos taurus OX=9913 GN=ARSA PE=2 SV=1
P51691	4.29e-46	31	462	4	513	Arylsulfatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atsA PE=1 SV=3
Q8A2H2	2.22e-40	31	466	34	505	N-acetylgalactosamine-6-O-sulfatase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_3333 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.048945	0.949364	0.000586	0.000499	0.000301	0.000290

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000053_01082.