CAZyme Information: MGYG000000049_03013

Basic Information

• Species: GCA-900066495 sp900066495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; GCA-900066495; GCA-900066495 sp900066495
• CAZyme ID: MGYG000000049_03013
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	MGYG000000049_11|CGC1	50977.1	9.8396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000049	3389401	Isolate	United Kingdom	Europe

• Gene Location: Start: 47438; End: 48769 Strand: -

Full Sequence      

MNNTINKNNGFYLSVKTKFFISILISILWVIFSYEVSKLWLNELSSITTPLIAFIIIAGV
AYVPGFMNAFLVGSLILDKQPKLKVLDPRDEVTLLISAYNEEIGIFETLRYVKNQDYKGK
IHTIVIDNNSSDNTSKEVERAKKELNMDIMLLHESKPGKFNALNYGLKYVKTKYVMTLDA
DTIIHKSAIKYLVSRVKTSPDDVCAVAGSMLVRNSRENLLAKIQEWDYFLSIASVKRMQG
LYQGTLVAQGAFSLYKTEVVKNVGGWSDAIGEDIVLTWKILSEGNRVYFEPMAVAFTDVP
VKLSHFVKQRSRWARGMIEGLREVKPWQQPSMFYKFLTGIDLIIPYMDFSYTFFWIPGLI
LALFFKKYYIVGPMMLLVLPLTLVSFWILYHYQANVVFKNLNLRVRKNFIGFALFILCYQ
MIMSPVSLYGYVQELFGAKRVWK

Enzyme Prediction     

No EC number prediction in MGYG000000049_03013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	89	316	1e-27	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.42e-50	94	273	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.96e-45	36	435	1	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	2.83e-40	60	442	14	411	N-glycosyltransferase; Provisional
PRK14583	hmsR	1.63e-28	92	429	77	412	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd06439	CESA_like_1	3.61e-27	79	320	18	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUN14224.1	8.10e-231	11	443	23	456
CEK38003.1	2.32e-230	11	443	23	456
CEJ73509.1	4.67e-230	11	443	23	456
QYE99472.1	2.55e-227	11	443	23	456
QOK29384.1	1.44e-201	12	442	20	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	7.02e-09	86	289	1	207	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5TZE_C	5.63e-08	93	206	4	118	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	8.11e-08	93	206	4	118	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
5EJ1_A	7.76e-06	66	321	104	379	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.99e-06	66	321	116	391	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99QX3	6.88e-39	62	316	9	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q6G608	6.88e-39	62	316	9	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q8NUI7	6.88e-39	62	316	9	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q6GDD8	6.88e-39	62	316	9	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	6.88e-39	62	316	9	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	36
51	73
342	364
368	390
410	432