CAZyme Information: MGYG000000047_01519

Basic Information

• Species: Clostridium disporicum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium disporicum_A
• CAZyme ID: MGYG000000047_01519
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000000047_9|CGC2	34962.38	8.9076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000047	3448648	Isolate	United Kingdom	Europe

• Gene Location: Start: 43795; End: 44700 Strand: -

Full Sequence      

MEKVAIVILNYLNYKDTIECVESLNNDKYCDKEVVIVDNGSNNDSWTVLEAKYCNSRVHL
LKSDKNLGFAKGNNIGINYAVNKLNCKFVLLVNNDTIFNDSNLITELMNAYEEGVAVIGP
RIIAANGVEQNPVPAEVSKARIEEEFAIYKSLKYRFYNGDLYIKLNENEYFKKMKIMIKK
YLLRRGNIDKKGEISNNKKSQDLVLHGACMLLTKDYFNYYSGLFPNTFLYYEENILTLLT
KKVGLYKKFINSVNIYHKEDQSSKMSFNNLSKVKKKYLFDSMKLCKELFDLSYDQIINKF
F

Enzyme Prediction     

No EC number prediction in MGYG000000047_01519.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	181	4.6e-19	0.9588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.36e-27	6	125	1	115	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.82e-26	1	264	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.37e-15	6	163	2	151	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02526	GT2_RfbF_like	3.82e-13	5	132	1	126	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd00761	Glyco_tranf_GTA_type	2.51e-11	6	126	1	120	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS52669.1	2.96e-57	3	284	2	270
QHQ60686.1	4.31e-57	1	298	1	271
QIK51207.1	1.61e-56	3	298	2	283
AZP04934.1	8.60e-55	3	274	2	266
CAI34098.1	1.09e-47	2	298	7	287

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU63	4.48e-08	1	233	17	199	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000047_01519.