CAZyme Information: MGYG000000047_00916

Basic Information

• Species: Clostridium disporicum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium disporicum_A
• CAZyme ID: MGYG000000047_00916
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	MGYG000000047_5|CGC2	38466.78	4.7704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000047	3448648	Isolate	United Kingdom	Europe

• Gene Location: Start: 68827; End: 69819 Strand: -

Full Sequence      

MEEKEISELDIPNFSLSNKNASIECKKLMKYFSSIFEKGIISGQHCNKATMPDIEYIRRV
TGKVPAILGFDFLSYSGEIETPESTFECIDELVNNKGSVEAALYWAKNTNAIITFCWHWF
SPLNGKDKSFYTKNTSFDLVKALIDGTEENLALIRDLDMIAYELKKFKDANVPILWRPLH
EACGGWFWWGAYGKEAYIKLYRLMYDRYVNYHNLNNLIWVWNSPDKEWYPGDDVVDINSA
DYYSSLGDNRPLIEEYNTFYSIPTTKKPLALGENGPIPDPELIKSSKAYWLWFMVWNNVS
EKIVWNSNDVLKRFFNDDFLITLEDLPKLR

Enzyme Prediction     

EC	3.2.1.78	3.2.1.151	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	17	324	1.1e-102	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.13e-61	18	322	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.60e-15	138	276	151	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA34445.1	7.50e-170	12	330	134	452
ADL51691.1	9.10e-138	12	326	135	448
BAV13096.1	9.10e-138	12	326	135	448
AZT91229.1	1.53e-114	1	330	121	451
ADL42284.1	1.75e-113	1	330	121	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	2.97e-74	13	330	142	451	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	3.54e-69	12	326	2	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.14e-55	22	327	40	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	6.41e-48	18	326	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	1.13e-46	16	296	45	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.05e-76	13	326	171	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	6.56e-63	18	323	30	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P49425	1.27e-61	12	330	142	461	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	2.45e-54	18	326	30	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55296	1.47e-51	13	327	154	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000047_00916.