CAZyme Information: MGYG000000045_02085

Basic Information

• Species: Faecalibacillus intestinalis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus intestinalis
• CAZyme ID: MGYG000000045_02085
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000000045_11|CGC2	54390.42	5.3728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000045	2722761	Isolate	United Kingdom	Europe

• Gene Location: Start: 30855; End: 32252 Strand: -

Full Sequence      

MNKSFLWGGAVAANQYEGGYQEGHKGLSVTDVMSAGDVDHPREISYEILDDKYYPNHYGI
DFYHHYKEDIKLFAEMGFKCFRLSISWPRIYPQGDELEPNEEGLEYYDHVFDECLKYGIE
PIVTLSHFEMPLYLAKKYGGWRNRQLITFFERYAITCFKRYSKKVKYWMTFNEINNLIDT
DNPFNAWTGAGVLYEDNENIEQTMYQISHYQFVASARAVQRAKEINASMQVGCMLHFGPI
YPSSCNPQDILAGIKAMDKRYFFSDVHVRGYYPTYTLKKWERSNIQLDITDEDLKDLKRG
TVDYIGFSYYKSTIAEYDKIHDFIEVQNPLLKKSDWGWAIDPTGLRIILNEVYERYQKPM
FIVENGFGAYDKLENGIINDDYRIDYLRNHISEMKKAIELDGVEVMGYTPWSAIDIVSAS
TGELAKRYGFIYVDLDDQAKGSGRRYRKASFEWYKRVISSNGEIL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	462	2.4e-146	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	3	465	6	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	465	6	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	465	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	464	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	463	8	475	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWM73973.1	3.90e-267	1	465	2	466
QYN58949.1	4.98e-253	1	465	2	466
QYN53197.1	1.00e-252	1	465	2	466
QYN55001.1	8.21e-252	1	465	2	466
SQJ16136.1	8.67e-218	3	465	7	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.16e-212	3	463	9	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.32e-212	3	463	9	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	3.50e-209	3	465	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	1.85e-204	3	463	9	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	3.87e-187	3	462	13	477	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.92e-208	3	465	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	3.43e-204	1	465	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	5.01e-177	3	465	10	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	3.67e-173	3	465	6	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	2.18e-169	3	465	9	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000045_02085.