CAZyme Information: MGYG000000044_00587

Basic Information

• Species: Parabacteroides merdae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides merdae
• CAZyme ID: MGYG000000044_00587
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	MGYG000000044_1|CGC11	65008.48	6.5031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000044	4300426	Isolate	United Kingdom	Europe

• Gene Location: Start: 688998; End: 690749 Strand: +

Full Sequence      

MKTLFILISLFFAVSLSARQRDSRVREYLPPARIVWQQESQLIQGANHLLLSGNGQSNLV
NHNICKLSSTDRQHPAILLDFGKELQGGLQIVTGMPASHEPVAVRIRLGESVSEAMCDID
GVNGASNDHAMRDFTIRLPWLGVMEVGNSGFRFARIDLLDDSVELHIKEIRAISVFRDIP
YKGSFRCNDERLNRIWQTGAYTVHLNMQEYIWDGIKRDRLVWIGDLHPEVMTVNTVFGYN
EVIPKSLDFIRDATPLPGWMNGMCSYSIWWLLIQRDWYYYQGDLAYLKEQKDYLTGLLRL
LISKVGDDGVEKLDGGGRFLDWPSSENPVAIDAGLQALMLQAMKAGNELCKVLGEDALAA
ECEAVGNRMTKAASKVIKPFLKSGVAPDAPGSKQAASLLALAGLMKPEEADRRYLAVNGG
HGFSTFYGYYMLRAMAAAGNYQGAIDVIRQFWGAMLDLGATTFWEDFNLDWLPGASRIDE
LVPVGKKDIHGDYGAYCYKGFRHSLCHGWASGPTSWLSEYVLGVQVVEPGCRVVRITPHL
GDLEWVEGTFPTPYGVITIRHEKGADGKVRSRIDAPSEVKVVR

Enzyme Prediction     

No EC number prediction in MGYG000000044_00587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	75	580	8.7e-104	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.80e-16	183	521	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.16e-06	523	580	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48045.1	0.0	1	583	1	583
QUT19201.1	0.0	7	581	5	580
ABR43079.1	0.0	7	581	5	580
QRO16730.1	0.0	7	581	5	580
BBK91321.1	0.0	7	581	5	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.79e-44	67	559	184	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.02e-17	66	522	88	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.23e-07	150	557	459	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000246	0.999162	0.000169	0.000138	0.000130	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000044_00587.