CAZyme Information: MGYG000000037_00581

Basic Information

• Species: Turicibacter sp001543345
• Lineage: Bacteria; Firmicutes; Bacilli; Haloplasmatales_A; Turicibacteraceae; Turicibacter; Turicibacter sp001543345
• CAZyme ID: MGYG000000037_00581
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000000037_5|CGC2	43003.43	4.6874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000037	2730783	Isolate	United Kingdom	Europe

• Gene Location: Start: 91189; End: 92295 Strand: +

Full Sequence      

MQQLEPYFKTYLKQFKPYKGFWCYEDGVILKGAVDLYRATNDDEYWSFVERYLNEFVDAK
GTLKGYKASEYNIDHVNAGKVLFDAYQKTKDERYRVAIEHQMDQLRTHPRTKSGNFWHKN
RYPYQVWLDGLYMALPFYTQYETVFNGLQNYEDIYHQFMEVYQTHRNSDNGLYYHAFDES
KSLFWCDKETGLSPNYWLRAEGWLLMALIDSIDQMSETIFEYYKGLIDMFIESIDAILPF
QDQQSGLWYQVIDQIDREGNYLEVSGSAMVIYSILKGIRLDILDKSYAKKALKGLQGILD
IYGYEDSTGYHIGGICEVAGLGSFNGVVRDGSFDYYISEKVVPDEAKGIGPLMMAYAEYL
MGGYSHEN

Enzyme Prediction     

No EC number prediction in MGYG000000037_00581.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	18	360	3.4e-105	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.83e-94	9	360	21	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.47e-76	22	361	27	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS20092.1	3.12e-236	1	367	2	368
AVQ19788.1	1.47e-140	2	358	6	364
ADD02984.1	2.37e-130	4	360	8	369
AEF18067.1	4.65e-130	1	360	1	358
AFK85204.1	1.33e-129	1	360	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.41e-99	22	359	23	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.04e-66	10	358	27	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.39e-66	10	358	17	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	9.46e-12	22	299	65	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.73e-10	22	299	66	330	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.70e-66	10	358	27	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.39e-42	133	361	1	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.39e-42	133	361	1	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000037_00581.