CAZyme Information: MGYG000000034_01725

Basic Information

• Species: Massilimaliae timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilimaliae; Massilimaliae timonensis
• CAZyme ID: MGYG000000034_01725
• CAZy Family: GH39
• CAZyme Description: Beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	MGYG000000034_3|CGC5	58277.42	4.5989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000034	2753532	Isolate	United Kingdom	Europe

• Gene Location: Start: 345075; End: 346622 Strand: -

Full Sequence      

MEQIRHIEIDAKKSIGKVPESPLFCVSAARANLLLRSDHQQHLKRAVQECGFQYLRFHGI
FQDDMGVYREDAFGAPVYSWQYVDQVYDFLLGIGIRPFVVFDFMPSALASGETTVYWEKA
NVTLPNSYEKWQNLITAATEHFTLRYGREEVKKWYFEVWNEPDNAPFFSGTFEDYCKLYD
VTARAVKAVCEDYRVGGPAISGNVEWVSGLIQYCSQNTVPLDFISAHSYSTKGFCEDGTH
LPALPGIPAWEPGPSWELGNQCYDPEGVLPAVLAVRKAISESAMPHLELHYTEWGLTWDY
WDSLRDSYHAASYILSRINAVSELVDSLSYCEISDVFEEDGPPSDSFHGGFGLLNLQGIR
KPAYFAYWFLSQLGTERIFCTDSNCIAAKKGNAYQVLVWNDAAHQDQENKRYYDHEVAPC
TAGRLQVAVSGLAPGNYLMKGYSAGYQKNDAYTMYLRMKKQESLSKEQVELLDSVSSGQP
FQISFFSCDEEGGATVVLDTLERENDVYLLSIIPY

Enzyme Prediction     

No EC number prediction in MGYG000000034_01725.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	24	417	4e-127	0.8839907192575406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	3.65e-102	7	484	3	468	Glycosyl hydrolases family 39.
COG3664	XynB	5.64e-59	34	515	1	427	Beta-xylosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63791.1	2.77e-205	5	512	37	544
QEY18934.1	2.74e-144	3	514	9	505
ABQ03810.1	3.25e-144	5	513	26	521
AWK03403.1	1.05e-142	5	513	26	521
QLC67063.1	3.37e-141	5	513	26	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M29_A	5.72e-102	5	514	9	498	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.14e-101	5	514	9	498	ChainA, Beta-xylosidase [Caulobacter vibrioides]
6UQJ_A	6.27e-100	5	514	14	505	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
1W91_A	8.36e-92	24	400	20	385	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	8.36e-92	24	400	20	385	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	6.62e-91	24	400	20	387	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
O30360	2.57e-85	24	417	20	401	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	3.62e-85	24	417	20	401	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
P23552	1.10e-79	3	485	5	461	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
P35475	1.20e-11	46	227	79	262	Alpha-L-iduronidase OS=Homo sapiens OX=9606 GN=IDUA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000034_01725.