CAZyme Information: MGYG000000033_01989

Basic Information

• Species: CAG-41 sp900066215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; CAG-41; CAG-41 sp900066215
• CAZyme ID: MGYG000000033_01989
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	MGYG000000033_16|CGC1	97963.07	4.8365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000033	3010191	Isolate	United Kingdom	Europe

• Gene Location: Start: 26616; End: 29165 Strand: -

Full Sequence      

MKIKRVISCLLVAVFSMSLLLVQESAQAKIGTVQKILPSELHVEGRYIYNAEGEKVRLTG
ANIPDLQWATGGDNDLMKRVGLLCDSWNANCVRLCVHSKFWFGQEWYQGKSYGDYRKMVD
NVINQITSRGKYVILNLHEFYAITEQQKDFWNDAVEVYGNNPGVIFGLLNEPHDIDWEMW
RNGGMLETTDSYGKKTQRVYGHQEILDMIRNKGAKNIVIAGGLDWSYYFDGLCDGYNGME
HGYKLEDKTGNGVIYDTHIYPMKPEYNPVEKAVECLVDEAPILVGEYGHWGERLFDWYDN
YLCEYPHVWMNEIHDFIDRNELNYTAWSFHTGANPNMFMDYDTFTPSNYSGIYMKYKMLQ
EPETRPEEKDRQYVDPSPLSTWEHIIDFDDNTVDFKVYGKEVRTERTDSGYEGRGQLIDF
DRSCVDSWDSAAIADFDKDTDLSGAKWLAVRIKGDGDMRKIGIGLELKDGRLFTTYMQMD
LHDNWKDWFFPLSLFKNEQGILDTTQIKSVLFTSLDDGPGSFIIDNIKVGGLPYEEIKPF
TVSSVTQKESMTWKAWEDDENTETDSFTVTNAVEESRGQGSNPVMFSYNCPEGSYGGQAR
ATIPKSWDIGDAEYFTFWAKGDGSKQRFILRFEQEKGTNQNEQRSNFKKREFERFCIAFD
VNSTEWKQYKFRISDLGMSDMLHLNKVRYISLFNMTLNSSGRLWIDDFAFTNIGDKLTGQ
SVSHATPVKSEPIGELVTKYPANKAIQIPKTFEVEAGIEEHISIHIMNKTEHELNGELKV
EGLPVDNVDNALYKVYPKWVSYPHWPWRNYSYSNFKFTIPKDKKGEYTITVSDVSNNGIE
PQTYKLIVK

Enzyme Prediction     

No EC number prediction in MGYG000000033_01989.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	48	337	1.3e-33	0.8618181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.08e-22	49	328	1	267	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	0.002	117	260	116	270	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam08547	CIA30	0.005	434	522	56	152	Complex I intermediate-associated protein 30 (CIA30). This protein is associated with mitochondrial Complex I intermediate-associated protein 30 (CIA30) in human and mouse. The family is also present in Schizosaccharomyces pombe which does not contain the NADH dehydrogenase component of complex I, or many of the other essential subunits. This means it is possible that this family of protein may not be directly involved in oxidative phosphorylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT50946.1	0.0	4	849	2	846
QIF03557.1	1.70e-61	38	361	406	730
AMV22357.1	3.10e-60	38	366	412	743
QDU27947.1	1.39e-59	38	355	408	726
ADR64665.1	1.03e-56	46	366	613	917

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HTY_A	3.72e-13	41	361	52	357	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
1A3H_A	2.17e-12	40	328	8	260	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	2.25e-12	40	328	11	263	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]
1H5V_A	2.27e-12	40	328	11	263	Thiopentasaccharidecomplex of the endoglucanase Cel5A from Bacillus agaradharens at 1.1 A resolution in the tetragonal crystal form [Salipaludibacillus agaradhaerens]
1E5J_A	2.30e-12	40	328	11	263	EndoglucanaseCel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Methyl-4ii-S-Alpha-Cellobiosyl-4ii-Thio Beta-Cellobioside [Salipaludibacillus agaradhaerens],1QHZ_A Native Tetragonal Structure Of The Endoglucanase Cel5a From Bacillus Agaradhaerens [Salipaludibacillus agaradhaerens],1QI0_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Cellobiose [Salipaludibacillus agaradhaerens],1QI2_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With 2',4'-Dinitrophenyl 2-Deoxy-2-Fluoro-B- D-Cellotrioside [Salipaludibacillus agaradhaerens],2V38_A Family 5 endoglucanase Cel5A from Bacillus agaradhaerens in complex with cellobio-derived noeuromycin [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07983	8.25e-14	7	328	9	292	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
O85465	1.13e-11	40	380	37	341	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P10475	2.21e-11	7	288	9	259	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P06565	2.78e-11	40	368	37	336	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P23549	1.09e-09	7	288	9	259	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999087	0.000201	0.000165	0.000157	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000033_01989.